KEGG   Homo sapiens (human): 114904
Entry
114904            CDS       T01001                                 

Gene name
C1QTNF6, CTFP6, CTRP6, ZACRP6
Definition
(RefSeq) C1q and TNF related 6
  KO
K19470  complement C1q tumor necrosis factor-related protein 1/6/8
Organism
hsa  Homo sapiens (human)
Disease
H00408  Type 1 diabetes mellitus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    114904 (C1QTNF6)
SSDB
Motif
Pfam: C1q Collagen GbpA_2
Other DBs
NCBI-GeneID: 114904
NCBI-ProteinID: NP_114116
OMIM: 614910
HGNC: 14343
Ensembl: ENSG00000133466
Vega: OTTHUMG00000150538
Pharos: Q9BXI9(Tbio)
UniProt: Q9BXI9 A0A024R1J0
Position
22q12.3
AA seq 278 aa
MQWLRVRESPGEATGHRVTMGTAALGPVWAALLLFLLMCEIPMVELTFDRAVASGCQRCC
DSEDPLDPAHVSSASSSGRPHALPEIRPYINITILKGDKGDPGPMGLPGYMGREGPQGEP
GPQGSKGDKGEMGSPGAPCQKRFFAFSVGRKTALHSGEDFQTLLFERVFVNLDGCFDMAT
GQFAAPLRGIYFFSLNVHSWNYKETYVHIMHNQKEAVILYAQPSERSIMQSQSVMLDLAY
GDRVWVRLFKRQRENAIYSNDFDTYITFSGHLIKAEDD
NT seq 837 nt   +upstreamnt  +downstreamnt
atgcagtggctcagggtccgtgagtcgcctggggaggccacaggacacagggtcaccatg
gggacagccgccctgggtcccgtctgggcagcgctcctgctctttctcctgatgtgtgag
atccctatggtggagctcacctttgacagagctgtggccagcggctgccaacggtgctgt
gactctgaggaccccctggatcctgcccatgtatcctcagcctcttcctccggccgcccc
cacgccctgcctgagatcagaccctacattaatatcaccatcctgaagggtgacaaaggg
gacccaggcccaatgggcctgccagggtacatgggcagggagggtccccaaggggagcct
ggccctcagggcagcaagggtgacaagggggagatgggcagccccggcgccccgtgccag
aagcgcttcttcgccttctcagtgggccgcaagacggccctgcacagcggcgaggacttc
cagacgctgctcttcgaaagggtctttgtgaaccttgatgggtgctttgacatggcgacc
ggccagtttgctgctcccctgcgtggcatctacttcttcagcctcaatgtgcacagctgg
aattacaaggagacgtacgtgcacattatgcataaccagaaagaggctgtcatcctgtac
gcgcagcccagcgagcgcagcatcatgcagagccagagtgtgatgctggacctggcctac
ggggaccgcgtctgggtgcggctcttcaagcgccagcgcgagaacgccatctacagcaac
gacttcgacacctacatcaccttcagcggccacctcatcaaggccgaggacgactga

DBGET integrated database retrieval system