KEGG   Homo sapiens (human): 114908Help
Entry
114908            CDS       T01001                                 

Gene name
TMEM123, KCT3, PORIMIN, PORMIN
Definition
(RefSeq) transmembrane protein 123
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: MGC-24 Endomucin SOG2 RIFIN
Motif
Other DBs
NCBI-GeneID: 114908
NCBI-ProteinID: NP_443164
OMIM: 606356
HGNC: 30138
Ensembl: ENSG00000152558
Vega: OTTHUMG00000167326
Pharos: Q8N131(Tbio)
UniProt: Q8N131
Position
11q22.2
AA seq 208 aa AA seqDB search
MGLGARGAWAALLLGTLQVLALLGAAHESAAMAASANIENSGLPHNSSANSTETLQHVPS
DHTNETSNSTVKPPTSVASDSSNTTVTTMKPTAASNTTTPGMVSTNMTSTTLKSTPKTTS
VSQNTSQISTSTMTVTHNSSVTSAASSVTITTTMHSEAKKGSKFDTGSFVGGIVLTLGVL
SILYIGCKMYYSRRGIRYRTIDEHDAII
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgggactcggcgcgcgaggtgcttgggccgcgctgctcctggggacgctgcaggtgcta
gcgctgctgggggccgcccatgaaagcgcagccatggcggcatctgcaaacatagagaat
tctgggcttccacacaactccagtgctaactcaacagagactctccaacatgtgccttct
gaccatacaaatgaaacttccaacagtactgtgaaaccaccaacttcagttgcctcagac
tccagtaatacaacggtcaccaccatgaaacctacagcggcatctaatacaacaacacca
gggatggtctcaacaaatatgacttctaccaccttaaagtctacacccaaaacaacaagt
gtttcacagaacacatctcagatatcaacatccacaatgaccgtaacccacaatagttca
gtgacatctgctgcttcatcagtaacaatcacaacaactatgcattctgaagcaaagaaa
ggatcaaaatttgatactgggagctttgttggtggtattgtattaacgctgggagtttta
tctattctttacattggatgcaaaatgtattactcaagaagaggcattcggtatcgaacc
atagatgaacatgatgccatcatttaa

DBGET integrated database retrieval system