KEGG   Homo sapiens (human): 114932
Entry
114932            CDS       T01001                                 

Gene name
MRFAP1L1, PP784
Definition
(RefSeq) Morf4 family associated protein 1 like 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: MRFAP1 FAM76 COG2 Med30
Other DBs
NCBI-GeneID: 114932
NCBI-ProteinID: NP_982287
HGNC: 28796
Ensembl: ENSG00000178988
Vega: OTTHUMG00000125507
Pharos: Q96HT8(Tdark)
UniProt: Q96HT8 A0A075DDR2
Position
4p16.1
AA seq 127 aa
MRPLDIDEVEAPEEVEVLEPEEDFEQFLLPVINEMREDIASLIREHGRAYLRTRSKLWEM
DNMLIQIKTQVEASEESALNHVQHPSGEADERVSELCEKAEEKAKEIAKMAEMLVELVWR
IERSESS
NT seq 384 nt   +upstreamnt  +downstreamnt
atgcggcccctggacatagacgaggtggaagcgcctgaggaagtggaggtgctggagccc
gaggaggatttcgagcagttcctgctcccggtcatcaacgagatgcgcgaggacatcgcg
tctcttatacgcgagcacgggcgggcgtacctgcggaccaggagcaagctgtgggagatg
gacaatatgcttatccagatcaaaacgcaggtggaggcctcggaggagagcgccctcaat
cacgtgcagcacccgagtggcgaagccgacgagagagtgtcggagttgtgcgagaaggct
gaggagaaagccaaggagattgcgaagatggcagagatgctggtcgagctcgtctggcga
atagagagaagcgagtcttcttga

DBGET integrated database retrieval system