KEGG   Homo sapiens (human): 114984
Entry
114984            CDS       T01001                                 
Symbol
FLYWCH2
Name
(RefSeq) FLYWCH family member 2
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: FLYWCH_N
Other DBs
NCBI-GeneID: 114984
NCBI-ProteinID: NP_001135971
HGNC: 25178
Ensembl: ENSG00000162076
Pharos: Q96CP2(Tdark)
UniProt: Q96CP2
Position
16:2883195..2899382
AA seq 140 aa
MPLPEPSEQEGESVKASQEPSPKPGTEVIPAAPRKPRKFSKLVLLTASKDSTKVAGAKRK
GVHCVMSLGVPGPATLAKALLQTHPEAQRAIEAAPQEPEQKRSRQDPGTDRTEDSGLAAG
PPEAAGENFAPCSVAPGKSL
NT seq 423 nt   +upstreamnt  +downstreamnt
atgcccctgcccgagcccagcgagcaggagggtgagagtgtgaaggccagccaggagcca
tcccccaagccaggcacagaagtcatcccggcagcccccaggaagcccagaaagttctcc
aaactggtcctgctcacagcctccaaagacagcaccaaggtggcgggggccaagcgcaag
ggtgtgcactgtgtcatgtccctgggggtgcccggccccgccacccttgccaaggccctc
ctccagacccaccccgaggcccagcgggccattgaggcagcccctcaggagcctgagcag
aaacggagcaggcaggacccaggcacagacagaacagaagacagtggattagcagcgggg
cctcctgaggctgctggggagaactttgccccctgctctgtggcgcccggcaagtccctg
taa

DBGET integrated database retrieval system