KEGG   Homo sapiens (human): 115Help
Entry
115               CDS       T01001                                 

Gene name
ADCY9, AC9, ACIX
Definition
(RefSeq) adenylate cyclase 9
  KO
K08049  adenylate cyclase 9 [EC:4.6.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01522  Endocrine resistance
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04114  Oocyte meiosis
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04270  Vascular smooth muscle contraction
hsa04371  Apelin signaling pathway
hsa04540  Gap junction
hsa04611  Platelet activation
hsa04713  Circadian entrainment
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04725  Cholinergic synapse
hsa04727  GABAergic synapse
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04911  Insulin secretion
hsa04912  GnRH signaling pathway
hsa04913  Ovarian steroidogenesis
hsa04914  Progesterone-mediated oocyte maturation
hsa04915  Estrogen signaling pathway
hsa04916  Melanogenesis
hsa04918  Thyroid hormone synthesis
hsa04921  Oxytocin signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
hsa04925  Aldosterone synthesis and secretion
hsa04926  Relaxin signaling pathway
hsa04927  Cortisol synthesis and secretion
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04934  Cushing syndrome
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa04962  Vasopressin-regulated water reabsorption
hsa04970  Salivary secretion
hsa04971  Gastric acid secretion
hsa04972  Pancreatic secretion
hsa04976  Bile secretion
hsa05032  Morphine addiction
hsa05110  Vibrio cholerae infection
hsa05163  Human cytomegalovirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
hsa05414  Dilated cardiomyopathy (DCM)
Module
hsa_M00695  cAMP signaling
Network
N00288  PTH-PTH1R-PKA signaling pathway
N00289  Mutation-inactivated GNAS to PTH-PTH1R-PKA signaling pathway
N00297  ACTH-cortisol signaling pathway
N00298  CYP11B1-CYP11B2 fusion to ACTH-cortisol signaling pathway
N00321  Mutation-activated GNAS to ACTH-cortisol signaling pathway
N00324  CRHR-PKA-ACTH signaling pathway
N00325  Mutation-inactivated RASD1 to CRHR-PKA-ACTH signaling pathway
N00326  Mutation-activated GNAS to CRHR-PKA-ACTH signaling pathway
N00327  Mutation-inactivated PRKAR1A to CRHR-PKA-ACTH signaling pathway
N00403  CX3CR1-GNAI-AC-PKA signaling pathway
N00404  HCMV US28 to GNAI-AC-PKA signaling pathway
N00411  HCMV UL33 to GNAS-AC-PKA signaling pathway
N00412  HCMV UL33 to GNAI-AC-PKA signaling pathway
 » show all
Drug target
Colforsin (DG02877): D01697 D03584
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    115 (ADCY9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    115 (ADCY9)
   04371 Apelin signaling pathway
    115 (ADCY9)
   04020 Calcium signaling pathway
    115 (ADCY9)
   04072 Phospholipase D signaling pathway
    115 (ADCY9)
   04024 cAMP signaling pathway
    115 (ADCY9)
   04022 cGMP-PKG signaling pathway
    115 (ADCY9)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    115 (ADCY9)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    115 (ADCY9)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    115 (ADCY9)
   04062 Chemokine signaling pathway
    115 (ADCY9)
  09152 Endocrine system
   04911 Insulin secretion
    115 (ADCY9)
   04923 Regulation of lipolysis in adipocytes
    115 (ADCY9)
   04912 GnRH signaling pathway
    115 (ADCY9)
   04913 Ovarian steroidogenesis
    115 (ADCY9)
   04915 Estrogen signaling pathway
    115 (ADCY9)
   04914 Progesterone-mediated oocyte maturation
    115 (ADCY9)
   04921 Oxytocin signaling pathway
    115 (ADCY9)
   04926 Relaxin signaling pathway
    115 (ADCY9)
   04918 Thyroid hormone synthesis
    115 (ADCY9)
   04928 Parathyroid hormone synthesis, secretion and action
    115 (ADCY9)
   04916 Melanogenesis
    115 (ADCY9)
   04925 Aldosterone synthesis and secretion
    115 (ADCY9)
   04927 Cortisol synthesis and secretion
    115 (ADCY9)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    115 (ADCY9)
   04270 Vascular smooth muscle contraction
    115 (ADCY9)
  09154 Digestive system
   04970 Salivary secretion
    115 (ADCY9)
   04971 Gastric acid secretion
    115 (ADCY9)
   04972 Pancreatic secretion
    115 (ADCY9)
   04976 Bile secretion
    115 (ADCY9)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    115 (ADCY9)
   04961 Endocrine and other factor-regulated calcium reabsorption
    115 (ADCY9)
  09156 Nervous system
   04724 Glutamatergic synapse
    115 (ADCY9)
   04727 GABAergic synapse
    115 (ADCY9)
   04725 Cholinergic synapse
    115 (ADCY9)
   04723 Retrograde endocannabinoid signaling
    115 (ADCY9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    115 (ADCY9)
  09149 Aging
   04211 Longevity regulating pathway
    115 (ADCY9)
   04213 Longevity regulating pathway - multiple species
    115 (ADCY9)
  09159 Environmental adaptation
   04713 Circadian entrainment
    115 (ADCY9)
   04714 Thermogenesis
    115 (ADCY9)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    115 (ADCY9)
  09165 Substance dependence
   05032 Morphine addiction
    115 (ADCY9)
  09166 Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    115 (ADCY9)
  09167 Endocrine and metabolic diseases
   04934 Cushing syndrome
    115 (ADCY9)
  09171 Infectious diseases: Bacterial
   05110 Vibrio cholerae infection
    115 (ADCY9)
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    115 (ADCY9)
   05163 Human cytomegalovirus infection
    115 (ADCY9)
  09176 Drug resistance: Antineoplastic
   01522 Endocrine resistance
    115 (ADCY9)
Enzymes [BR:hsa01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     115 (ADCY9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc DUF1053 DUF512 zf-C2HC_2 AC_N
Motif
Other DBs
NCBI-GeneID: 115
NCBI-ProteinID: NP_001107
OMIM: 603302
HGNC: 240
Ensembl: ENSG00000162104
Vega: OTTHUMG00000177612
Pharos: O60503(Tbio)
UniProt: O60503
Position
16p13.3
AA seq 1353 aa AA seqDB search
MASPPHQQLLHHHSTEVSCDSSGDSNSVRVKINPKQLSSNSHPKHCKYSISSSCSSSGDS
GGVPRRVGGGGRLRRQKKLPQLFERASSRWWDPKFDSVNLEEACLERCFPQTQRRFRYAL
FYIGFACLLWSIYFAVHMRSRLIVMVAPALCFLLVCVGFFLFTFTKLYARHYAWTSLALT
LLVFALTLAAQFQVLTPVSGRGDSSNLTATARPTDTCLSQVGSFSMCIEVLFLLYTVMHL
PLYLSLCLGVAYSVLFETFGYHFRDEACFPSPGAGALHWELLSRGLLHGCIHAIGVHLFV
MSQVRSRSTFLKVGQSIMHGKDLEVEKALKERMIHSVMPRIIADDLMKQGDEESENSVKR
HATSSPKNRKKKSSIQKAPIAFRPFKMQQIEEVSILFADIVGFTKMSANKSAHALVGLLN
DLFGRFDRLCEETKCEKISTLGDCYYCVAGCPEPRADHAYCCIEMGLGMIKAIEQFCQEK
KEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYLD
DRYEMEDGKVIERLGQSVVADQLKGLKTYLISGQRAKESRCSCAEALLSGFEVIDGSQVS
SGPRGQGTASSGNVSDLAQTVKTFDNLKTCPSCGITFAPKSEAGAEGGAPQNGCQDEHKN
STKASGGPNPKTQNGLLSPPQEEKLTNSQTSLCEILQEKGRWAGVSLDQSALLPLRFKNI
REKTDAHFVDVIKEDSLMKDYFFKPPINQFSLNFLDQELERSYRTSYQEEVIKNSPVKTF
ASPTFSSLLDVFLSTTVFLTLSTTCFLKYEAATVPPPPAALAVFSAALLLEVLSLAVSIR
MVFFLEDVMACTKRLLEWIAGWLPRHCIGAILVSLPALAVYSHVTSEYETNIHFPVFTGS
AALIAVVHYCNFCQLSSWMRSSLATVVGAGPLLLLYVSLCPDSSVLTSPLDAVQNFSSER
NPCNSSVPRDLRRPASLIGQEVVLVFFLLLLLVWFLNREFEVSYRLHYHGDVEADLHRTK
IQSMRDQADWLLRNIIPYHVAEQLKVSQTYSKNHDSGGVIFASIVNFSEFYEENYEGGKE
CYRVLNELIGDFDELLSKPDYSSIEKIKTIGATYMAASGLNTAQAQDGSHPQEHLQILFE
FAKEMMRVVDDFNNNMLWFNFKLRVGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTT
GVECRIQVSEESYRVLSKMGYDFDYRGTVNVKGKGQMKTYLYPKCTDHRVIPQHQLSISP
DIRVQVDGSIGRSPTDEIANLVPSVQYVDKTSLGSDSSTQAKDAHLSPKRPWKEPVKAEE
RGRFGKAIEKDDCDETGIEEANELTKLNVSKSV
NT seq 4062 nt NT seq  +upstreamnt  +downstreamnt
atggcttccccaccccaccagcagctgctgcatcaccacagcaccgaggtgagctgcgac
tccagcggggacagcaacagcgtgcgcgtcaagatcaaccccaagcagctgtcctccaac
agccaccccaagcactgcaaatacagcatctcctctagctgcagcagctctggggactcc
gggggcgtcccccggcgagtgggcggcggaggccggctgcgcaggcagaagaagctgccc
cagctgttcgagagggcctccagccgctggtgggaccccaagttcgactcggtgaacctg
gaggaggcctgcctggagcgctgcttcccgcagacccagcgccggttccggtatgcgctc
ttctacatcggcttcgcctgccttctgtggagcatctattttgcggtccacatgagatcc
agactgatcgtcatggtcgcccccgcgctgtgcttcctcctggtgtgtgtgggcttcttt
ctgtttaccttcaccaagctgtacgcccggcattacgcgtggacctcgctggctctcacc
ctgctggtgttcgccctgaccctggctgcgcagttccaggtcttgacgcctgtctcagga
cgcggcgacagctccaaccttacggccacagcccggcccacagatacttgcttatctcaa
gtggggagcttctccatgtgcatcgaagtgctctttttgctctataccgtcatgcactta
cctttgtacctgagtttgtgtctgggggtggcctactctgtccttttcgagacctttggc
taccatttccgggatgaagcctgcttcccctcgcccggagccggggccctgcactgggag
ctgctgagcagggggctgctccacggctgcatccacgccatcggggtccacctgttcgtc
atgtcccaggtgaggtccaggagcaccttcctcaaggtggggcaatccattatgcacggg
aaggacctggaagtggaaaaagccctcaaagagaggatgattcattccgtgatgccaaga
atcatagccgatgacttaatgaagcagggagatgaggagagtgagaattctgtcaagagg
catgccacctcgagccccaagaacaggaagaaaaagtcttccatccaaaaagctcctata
gccttccgcccttttaagatgcagcagatcgaagaagtcagtattttatttgcagatatc
gtgggcttcaccaagatgagtgccaacaagtctgcccacgccctggtgggtctcctgaac
gatctgttcggtcgcttcgaccgcctgtgtgaggagaccaagtgtgagaaaatcagcacc
ctgggagactgttactactgcgtggcgggctgtcccgagccccgggccgaccatgcctac
tgctgcatcgagatgggcctgggcatgatcaaggccatcgagcagttctgccaggagaag
aaggagatggtgaacatgagagtcggggtgcacacgggcaccgtcctttgcggcatcctg
ggcatgaggaggtttaaatttgacgtgtggtccaacgatgtgaacctggccaatctcatg
gagcagctgggagtggccggcaaagttcacatttctgaggccaccgcaaaatacttagat
gaccggtacgaaatggaagatgggaaagttattgaacggctgggccagagcgtggttgct
gaccagttgaaaggtttgaagacatacctgatatcgggtcagagagccaaggagtctcgc
tgcagctgtgcagaggccttgctttctggctttgaggtcattgacggctcacaggtgtcc
tcaggccctaggggacaggggacagcgtcatcagggaatgtcagtgacttggcgcagact
gtcaaaacctttgataaccttaagacctgcccttcgtgcggaatcacatttgctcccaaa
tctgaagccggcgccgagggaggagcacctcaaaacggctgccaagacgagcataaaaac
agcaccaaggcttctggaggacctaatcccaaaactcagaacgggctcctcagccctccc
caagaggagaagctcaccaacagtcagacttctctgtgtgagatcttgcaggagaaggga
aggtgggcaggggtgagcctggaccagtcggctctccttccgctgaggttcaagaacatc
cgggagaaaacggacgcccactttgtggacgttatcaaagaagacagcctgatgaaagat
tacttttttaagccgcccattaatcagttcagcctgaacttcctggatcaggagctggag
cgatcctacaggaccagctatcaggaagaggtcataaagaactcccccgtgaagacgttt
gctagtcccaccttcagctccctcctggatgtgtttctgtcgaccacagtgtttctgacg
ctgtccaccacctgcttcctgaagtacgaggcggccaccgtgcctcccccgcccgccgcc
ctggcggtcttcagtgcagccctgctgctggaggtgctgtccctcgcggtgtccatcagg
atggtgttcttcctggaggacgtcatggcctgcaccaagcgcctgctggagtggatcgcc
ggctggctaccacgtcactgcatcggggccatcctggtgtcgcttcccgcactggccgtc
tactcccatgtcacctccgaatatgagaccaacatacacttcccagtgttcacaggctcg
gccgcgctgattgccgtcgtgcactactgtaacttctgccagctcagctcctggatgagg
tcctccctcgccaccgtcgtgggggccgggccgctgctcctgctctacgtctccctgtgc
ccagacagttctgtattaacttcgccccttgacgcagtacagaatttcagttccgagagg
aacccgtgcaatagttcggtgccgcgtgacctccggcggcccgccagcctcatcggccag
gaggtggttctcgtcttctttctcctgctcttgttggtctggttcctgaatcgcgaattt
gaagtcagctaccgcctccactaccacggagacgtggaagcggatcttcaccgcaccaag
atccagagcatgcgggaccaggcagactggctgctgaggaacatcatcccctaccacgtg
gctgagcagctgaaggtgtcccagacctactccaagaaccatgacagcggaggggtgatc
ttcgccagcatcgtcaacttcagcgagttctacgaggagaactacgagggcggcaaggag
tgctaccgggtcctcaacgagctcatcggggactttgacgagctcctaagcaagccggac
tacagcagcatcgagaagatcaagaccatcggagccacgtacatggcggcgtcagggctg
aacaccgcgcaggcccaggacggcagccacccgcaggagcacctgcagatcctgttcgag
ttcgccaaggagatgatgcgcgtggtggacgacttcaacaacaacatgctgtggttcaac
ttcaagctccgcgtcggcttcaaccatgggcccctcacggccggggtcatcggcaccacc
aagctgctgtacgacatctggggagacaccgtcaacatcgccagcaggatggacaccacc
ggcgtggagtgccgcatccaggtgagcgaagagagctaccgcgtcttgagcaagatgggc
tatgacttcgactacagagggaccgtgaatgtcaaggggaaaggccagatgaagacctac
ctgtacccaaagtgcacggatcacagggtcatcccacagcaccagctgtccatctcccca
gacatccgcgtccaggtggatggcagcatcggacggtctcccacagacgagattgccaac
ctggtgccttctgtccagtatgtggacaagacatctctgggttctgacagcagcacgcag
gccaaggatgcccacctgtcccccaagagaccgtggaaggagcccgtcaaagccgaagaa
aggggtcgatttggcaaagccatagagaaagacgactgtgacgaaacaggaatagaagaa
gccaacgaactcaccaagctcaacgtttcaaagagtgtgtga

DBGET integrated database retrieval system