KEGG   Homo sapiens (human): 115098
Entry
115098            CDS       T01001                                 
Symbol
CCDC124, Lso2, oxs1
Name
(RefSeq) coiled-coil domain containing 124
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Ccdc124 HMG_box
Other DBs
NCBI-GeneID: 115098
NCBI-ProteinID: NP_001129675
HGNC: 25171
Ensembl: ENSG00000007080
Pharos: Q96CT7(Tdark)
UniProt: Q96CT7 A0A024R7M8
Structure
Position
19:17933015..17943985
AA seq 223 aa
MPKKFQGENTKSAAARARRAEAKAAADAKKQKELEDAYWKDDDKHVMRKEQRKEEKEKRR
LDQLERKKETQRLLEEEDSKLKGGKAPRVATSSKVTRAQIEDTLRRDHQLREAPDTAEKA
KSHLEVPLEENVNRRVLEEGSVEARTIEDAIAVLSVAEEAADRHPERRMRAAFTAFEEAQ
LPRLKQENPNMRLSQLKQLLKKEWLRSPDNPMNQRAVPFNAPK
NT seq 672 nt   +upstreamnt  +downstreamnt
atgcccaagaagttccagggtgagaacaccaagtcggcagcggcccgggcacgtagggca
gaggccaaggcggccgctgatgccaagaagcagaaggagctggaggatgcctactggaag
gacgacgacaaacacgtcatgaggaaggagcagcgcaaggaggagaaggagaagcggcgc
ctcgaccagctggaacgtaagaaggagacgcagcgcctactggaggaggaggactccaag
ctcaagggcggcaaggcgccgcgggtggccacgtccagcaaggtcacccgggcccagatc
gaggacacgctgcgccgagaccatcagctcagggaggccccggacacagccgagaaagcc
aagagccatctggaggtgccgctggaggagaacgtgaaccgccgcgtgctggaggagggc
agcgtggaggcgcgcaccatcgaggacgccattgcagtgctcagcgtggcggaggaggcg
gccgaccggcacccagaaagacgcatgcgggcagccttcacagcctttgaggaagcccag
ctgccgcggctcaaacaagagaaccccaacatgcggctgtcgcagctgaaacagctgctc
aagaaggagtggctccgctctcctgacaaccccatgaaccagcgggccgtgcccttcaat
gcccccaagtga

DBGET integrated database retrieval system