KEGG   Homo sapiens (human): 115111Help
Entry
115111            CDS       T01001                                 

Gene name
SLC26A7, SUT2
Definition
(RefSeq) solute carrier family 26 member 7
  KO
K13962  solute carrier family 26 (anion exchange transporter), member 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04971 Gastric acid secretion
    115111 (SLC26A7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    115111 (SLC26A7)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC26: Multifunctional anion exchanger
   115111 (SLC26A7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sulfate_transp STAS STAS_2
Motif
Other DBs
NCBI-GeneID: 115111
NCBI-ProteinID: NP_001269285
OMIM: 608479
HGNC: 14467
Ensembl: ENSG00000147606
Vega: OTTHUMG00000164062
Pharos: Q8TE54(Tbio)
UniProt: Q8TE54
Position
8q21.3
AA seq 656 aa AA seqDB search
MTGAKRKKKSMLWSKMHTPQCEDIIQWCRRRLPILDWAPHYNLKENLLPDTVSGIMLAVQ
QVTQGLAFAVLSSVHPVFGLYGSLFPAIIYAIFGMGHHVATGTFALTSLISANAVERIVP
QNMQNLTTQSNTSVLGLSDFEMQRIHVAAAVSFLGGVIQVAMFVLQLGSATFVVTEPVIS
AMTTGAATHVVTSQVKYLLGMKMPYISGPLGFFYIYAYVFENIKSVRLEALLLSLLSIVV
LVLVKELNEQFKRKIKVVLPVDLVLIIAASFACYCTNMENTYGLEVVGHIPQGIPSPRAP
PMNILSAVITEAFGVALVGYVASLALAQGSAKKFKYSIDDNQEFLAHGLSNIVSSFFFCI
PSAAAMGRTAGLYSTGAKTQVACLISCIFVLIVIYAIGPLLYWLPMCVLASIIVVGLKGM
LIQFRDLKKYWNVDKIDWGIWVSTYVFTICFAANVGLLFGVVCTIAIVIGRFPRAMTVSI
KNMKEMEFKVKTEMDSETLQQVKIISINNPLVFLNAKKFYTDLMNMIQKENACNQPLDDI
SKCEQNTLLNSLSNGNCNEEASQSCPNEKCYLILDCSGFTFFDYSGVSMLVEVYMDCKGR
SVDVLLAHCTASLIKAMTYYGNLDSEKPIFFESVSAAISHIHSNKNLSKLSDHSEV
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgacaggagcaaagaggaaaaagaaaagcatgctttggagcaagatgcataccccccag
tgtgaagacattatacagtggtgtagaaggcgactgcccattttggattgggcaccacat
tacaatctgaaagaaaacttgcttccagacactgtgtctgggataatgttggcagttcaa
caggtgacccaaggattggcctttgctgttctctcatctgtgcacccagtgtttggttta
tatgggtctctgtttcctgccataatttatgccatatttggaatgggacatcatgttgcc
acaggcacctttgccttgacatccttaatatcagccaacgccgtggaacggattgtccct
cagaacatgcagaatctcaccacacagagtaacacaagcgtgctgggcttatccgacttt
gaaatgcaaaggatccacgttgctgcagcagtttccttcttgggaggtgtgattcaggtg
gccatgtttgtgctgcaactgggcagtgccacatttgtggtcacagagcctgtgatcagc
gcaatgacaactggggctgccacccatgtggtgacttcacaagtcaaatatctcttggga
atgaaaatgccatatatatccggaccacttggattcttttatatttatgcatatgttttt
gaaaacatcaagtctgtgcgactggaagcattgcttttatccttgctgagcattgtggtc
cttgttcttgttaaagagctgaatgaacagtttaaaaggaaaattaaagttgttcttcct
gtagatttagttttgattattgctgcatcatttgcttgttattgcaccaatatggaaaac
acatatggattagaagtagttggtcatattccacaaggaattccctcacctagagctccc
ccgatgaacatcctctctgcggtgatcactgaagctttcggagtggcacttgtaggctat
gtggcctcactggctcttgctcaaggatctgccaaaaaattcaaatattcaattgatgac
aaccaggaatttttggcccatggcctcagcaatatagtttcttcatttttcttctgcata
ccaagtgctgctgccatgggaaggacggctggcctgtacagcacaggagcgaagacacag
gtggcttgtctaatatcttgcattttcgtccttatagtcatctatgcaataggacctttg
ctttactggctgcccatgtgtgtccttgcaagcattattgttgtgggactgaagggaatg
ctaatacagttccgagatttaaaaaaatattggaatgtggataaaatcgattggggaata
tgggtcagtacatatgtatttacaatatgctttgctgccaatgtgggactgctgtttggt
gttgtttgtaccatagctatagtgataggacgcttcccaagagcaatgactgtaagtata
aaaaatatgaaagaaatggaatttaaagtgaagacagaaatggacagtgaaaccctgcag
caggtgaaaattatctcaataaacaacccgcttgttttcctgaatgcaaaaaaattttat
actgatttaatgaacatgatccaaaaggaaaatgcctgtaatcagccacttgatgatatc
agcaagtgtgaacaaaacacattgcttaattccctatccaatggcaactgcaatgaagaa
gcttcacagtcctgccctaatgagaagtgttatttaatcctggattgcagtggatttacc
ttttttgactattctggagtctccatgcttgttgaggtttacatggactgtaaaggcagg
agtgtggatgtattgttagcccattgtacagcttccttgataaaagcaatgacgtattat
ggaaacctagactcagagaaaccaattttttttgaatcggtatctgctgcaataagtcat
atccattcaaataagaatttgagcaaactcagtgaccacagtgaagtctga

DBGET integrated database retrieval system