KEGG   Homo sapiens (human): 1152Help
Entry
1152              CDS       T01001                                 

Gene name
CKB, B-CK, BCK, CKBB, CPK-B, HEL-211, HEL-S-29
Definition
(RefSeq) creatine kinase B
  KO
K00933  creatine kinase [EC:2.7.3.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00330  Arginine and proline metabolism
hsa01100  Metabolic pathways
Module
hsa_M00047  Creatine pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    1152 (CKB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1152 (CKB)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.2  creatine kinase
     1152 (CKB)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   1152 (CKB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-gua_Ptrans ATP-gua_PtransN
Motif
Other DBs
NCBI-GeneID: 1152
NCBI-ProteinID: NP_001814
OMIM: 123280
HGNC: 1991
Ensembl: ENSG00000166165
Vega: OTTHUMG00000171786
Pharos: P12277(Tbio)
UniProt: P12277 V9HWH2
Structure
PDB: 

Position
14q32.33
AA seq 381 aa AA seqDB search
MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTG
VDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDD
LDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMT
EAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISM
QKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLP
NLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLL
IEMEQRLEQGQAIDDLMPAQK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgcccttctccaacagccacaacgcactgaagctgcgcttcccggccgaggacgagttc
cccgacctgagcgcccacaacaaccacatggccaaggtgctgacccccgagctgtacgcg
gagctgcgcgccaagagcacgccgagcggcttcacgctggacgacgtcatccagacaggc
gtggacaacccgggccacccgtacatcatgaccgtgggctgcgtggcgggcgacgaggag
tcctacgaagtgttcaaggatctcttcgaccccatcatcgaggaccggcacggcggctac
aagcccagcgatgagcacaagaccgacctcaaccccgacaacctgcagggcggcgacgac
ctggaccccaactacgtgctgagctcgcgggtgcgcacgggccgcagcatccgtggcttc
tgcctccccccgcactgcagccgcggggagcgccgcgccatcgagaagctcgcggtggaa
gccctgtccagcctggacggcgacctggcgggccgatactacgcgctcaagagcatgacg
gaggcggagcagcagcagctcatcgacgaccacttcctcttcgacaagcccgtgtcgccc
ctgctgctggcctcgggcatggcccgcgactggcccgacgcccgcggtatctggcacaat
gacaataagaccttcctggtgtgggtcaacgaggaggaccacctgcgggtcatctccatg
cagaaggggggcaacatgaaggaggtgttcacccgcttctgcaccggcctcacccagatt
gaaactctcttcaagtctaaggactatgagttcatgtggaaccctcacctgggctacatc
ctcacctgcccatccaacctgggcaccgggctgcgggcaggtgtgcatatcaagctgccc
aacctgggcaagcatgagaagttctcggaggtgcttaagcggctgcgacttcagaagcga
ggcacaggcggtgtggacacggctgcggtgggcggggtcttcgacgtctccaacgctgac
cgcctgggcttctcagaggtggagctggtgcagatggtggtggacggagtgaagctgctc
atcgagatggagcagcggctggagcagggccaggccatcgacgacctcatgcctgcccag
aaatga

KEGG   Homo sapiens (human): 1158Help
Entry
1158              CDS       T01001                                 

Gene name
CKM, CKMM, CPK-M, M-CK
Definition
(RefSeq) creatine kinase, M-type
  KO
K00933  creatine kinase [EC:2.7.3.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00330  Arginine and proline metabolism
hsa01100  Metabolic pathways
Module
hsa_M00047  Creatine pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    1158 (CKM)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1158 (CKM)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.2  creatine kinase
     1158 (CKM)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   1158 (CKM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-gua_Ptrans ATP-gua_PtransN
Motif
Other DBs
NCBI-GeneID: 1158
NCBI-ProteinID: NP_001815
OMIM: 123310
HGNC: 1994
Ensembl: ENSG00000104879
Vega: OTTHUMG00000181782
Pharos: P06732(Tbio)
UniProt: P06732 B2R892
Structure
PDB: 

Position
19q13.32
AA seq 381 aa AA seqDB search
MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTG
VDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDD
LDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMT
EKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISM
EKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLA
HLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLM
VEMEKKLEKGQSIDDMIPAQK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgccattcggtaacacccacaacaagttcaagctgaattacaagcctgaggaggagtac
cccgacctcagcaaacataacaaccacatggccaaggtactgacccttgaactctacaag
aagctgcgggacaaggagactccatctggcttcactgtagacgatgtcatccagacagga
gtggacaacccaggtcaccccttcatcatgaccgtgggctgcgtggctggtgatgaggag
tcctacgaagttttcaaggaactctttgaccccatcatctcggatcgccacgggggctac
aaacccactgacaagcacaagactgacctcaaccatgaaaacctcaagggtggagacgac
ctggaccctaactacgtgctcagcagccgcgtccgcactggccgcagcatcaagggctac
acgttgcccccacactgctcccgtggcgagcgccgggcggtggagaagctctctgtggaa
gctctcaacagcctgacgggcgagttcaaagggaagtactaccctctgaagagcatgacg
gagaaggagcagcagcagctcatcgatgaccacttcctgttcgacaagcccgtgtccccg
ctgctgctggcctcaggcatggcccgcgactggcccgacgcccgtggcatctggcacaat
gacaacaagagcttcctggtgtgggtgaacgaggaggatcacctccgggtcatctccatg
gagaaggggggcaacatgaaggaggttttccgccgcttctgcgtagggctgcagaagatt
gaggagatctttaagaaagctggccaccccttcatgtggaaccagcacctgggctacgtg
ctcacctgcccatccaacctgggcactgggctgcgtggaggcgtgcatgtgaagctggcg
cacctgagcaagcaccccaagttcgaggagatcctcacccgcctgcgtctgcagaagagg
ggtacaggtggcgtggacacagctgccgtgggctcagtatttgacgtgtccaacgctgat
cggctgggctcgtccgaagtagaacaggtgcagctggtggtggatggtgtgaagctcatg
gtggaaatggagaagaagttggagaaaggccagtccattgacgacatgatccccgcccag
aagtag

KEGG   Homo sapiens (human): 1159Help
Entry
1159              CDS       T01001                                 

Gene name
CKMT1B, CKMT, CKMT1, UMTCK
Definition
(RefSeq) creatine kinase, mitochondrial 1B
  KO
K00933  creatine kinase [EC:2.7.3.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00330  Arginine and proline metabolism
hsa01100  Metabolic pathways
Module
hsa_M00047  Creatine pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    1159 (CKMT1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1159 (CKMT1B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.2  creatine kinase
     1159 (CKMT1B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   1159 (CKMT1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-gua_Ptrans ATP-gua_PtransN
Motif
Other DBs
NCBI-GeneID: 1159
NCBI-ProteinID: NP_066270
OMIM: 123290
HGNC: 1995
Ensembl: ENSG00000237289
Vega: OTTHUMG00000059900
UniProt: P12532
Structure
PDB: 

Position
15q15.3
AA seq 417 aa AA seqDB search
MAGPFSRLLSARPGLRLLALAGAGSLAAGFLLRPEPVRAASERRRLYPPSAEYPDLRKHN
NCMASHLTPAVYARLCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYEVFAD
LFDPVIQERHNGYDPRTMKHTTDLDASKIRSGYFDERYVLSSRVRTGRSIRGLSLPPACT
RAERREVERVVVDALSGLKGDLAGRYYRLSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGM
ARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQER
GWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDT
AATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLERGQDIRIPTPVIHTKH
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggctggtcccttctcccgtctgctgtccgcccgcccgggactcaggctcctggctttg
gccggagcggggtctctagccgctgggtttctgctccgaccggaacctgtacgagctgcc
agtgaacgacggaggctgtatcccccgagcgctgagtacccagacctccgaaagcacaac
aactgcatggccagtcacctgaccccagcagtctatgcacggctctgcgacaagaccaca
cccactggttggacgctagatcagtgtatccagactggcgtggacaaccctggccacccc
ttcatcaagactgtgggcatggtggctggagatgaggagacctatgaggtatttgctgac
ctgtttgaccctgtgatccaagagcgacacaatggatatgacccccggacaatgaagcac
accacggatctagatgccagtaaaatccgttctggctactttgatgagaggtatgtattg
tcctctagagtcagaactggccgaagcatccgaggactcagtctgcctccagcttgcact
cgagcagagcgacgagaggtggaacgtgttgtggtggatgcactgagtggcctgaagggt
gacctggctggacgttactataggctcagtgagatgacagaggctgaacagcagcagctt
attgatgaccactttctgtttgataagcctgtgtccccgttgctgactgcagcaggaatg
gctcgagactggccagatgctcgtggaatttggcacaacaatgagaagagcttcctgatc
tgggtgaatgaggaggatcatacacgggtgatctccatggagaagggtggtaacatgaag
agagtgtttgaaagattctgccgaggcctcaaagaggtggagagacttatccaagaacgt
ggctgggagttcatgtggaatgagcgtttgggatacatcttgacctgtccatctaacctg
ggcactggacttcgggcaggagtgcacatcaaactgcccctgctaagcaaagatagccgc
ttcccaaagatcctggagaacctaagactccaaaaacgtggtactggaggagtggacact
gctgctacaggcggtgtctttgatatttctaatttggaccgactaggcaaatcagaggtg
gagctggtgcaactggtcatcgatggagtaaactatttgattgattgtgaacggcgtctg
gagagaggccaggatatccgcatccccacacctgtcatccacaccaagcattaa

KEGG   Homo sapiens (human): 1160Help
Entry
1160              CDS       T01001                                 

Gene name
CKMT2, SMTCK
Definition
(RefSeq) creatine kinase, mitochondrial 2
  KO
K00933  creatine kinase [EC:2.7.3.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00330  Arginine and proline metabolism
hsa01100  Metabolic pathways
Module
hsa_M00047  Creatine pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    1160 (CKMT2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1160 (CKMT2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.2  creatine kinase
     1160 (CKMT2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   1160 (CKMT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-gua_Ptrans ATP-gua_PtransN
Motif
Other DBs
NCBI-GeneID: 1160
NCBI-ProteinID: NP_001093205
OMIM: 123295
HGNC: 1996
Ensembl: ENSG00000131730
Vega: OTTHUMG00000119013
Pharos: P17540(Tbio)
UniProt: P17540 A0A024RAK5
Structure
PDB: 

Position
5q14.1
AA seq 419 aa AA seqDB search
MASIFSKLLTGRNASLLFATMGTSVLTTGYLLNRQKVCAEVREQPRLFPPSADYPDLRKH
NNCMAECLTPAIYAKLRNKVTPNGYTLDQCIQTGVDNPGHPFIKTVGMVAGDEESYEVFA
DLFDPVIKLRHNGYDPRVMKHTTDLDASKITQGQFDEHYVLSSRVRTGRSIRGLSLPPAC
TRAERREVENVAITALEGLKGDLAGRYYKLSEMTEQDQQRLIDDHFLFDKPVSPLLTCAG
MARDWPDARGIWHNYDKTFLIWINEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQE
RGWEFMWNERLGYILTCPSNLGTGLRAGVHVRIPKLSKDPRFSKILENLRLQKRGTGGVD
TAAVADVYDISNIDRIGRSEVELVQIVIDGVNYLVDCEKKLERGQDIKVPPPLPQFGKK
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggccagtatcttttctaagttgctaactggccgcaatgcttctctgctgtttgctacc
atgggcaccagtgtcctgaccaccgggtacctgctgaaccggcagaaagtgtgtgccgag
gtccgggagcagcctaggctatttcctccaagcgcagactacccagacctgcgcaagcac
aacaactgcatggccgagtgcctcacccccgccatttatgccaagcttcgcaacaaggtg
acacccaacggctacacgctggaccagtgcatccagactggagtggacaaccctggccac
cccttcataaagactgtgggcatggtggctggtgacgaggagtcctatgaggtgtttgct
gacctttttgaccccgtcatcaaactaagacacaacggctatgaccccagggtgatgaag
cacacaacggatctggatgcatcaaagatcacccaagggcagttcgacgagcattacgtg
ctgtcttctcgggtgcgcactggccgcagcatccgtgggctgagcctgcctccagcctgc
acccgggccgagcgaagggaggtagagaacgtggccatcactgccctggagggcctcaag
ggggacctggctggccgctactacaagctgtccgagatgacggagcaggaccagcagcgg
ctcatcgatgaccactttctgtttgataagccagtgtcccctttattaacatgtgctggg
atggcccgtgactggccagatgccaggggaatctggcataattatgataagacatttctc
atctggataaatgaggaggatcacaccagggtaatctcaatggaaaaaggaggcaatatg
aaacgagtatttgagcgattctgtcgtggactaaaagaagtagaacggttaatccaagaa
cgaggctgggagttcatgtggaatgagcgcctaggatacattttgacctgtccttcgaac
cttggaacaggactacgagctggtgtccacgttaggatcccaaagctcagcaaggaccca
cgcttttctaagatcctggaaaacctaagactccagaagcgtggcacaggtggtgtggac
actgccgcggtcgcagatgtgtacgacatttccaacatagatagaattggtcgatcagag
gttgagcttgttcagatagtcatcgatggagtcaattacctggtggattgtgaaaagaag
ttggagagaggccaagatattaaggtgccaccccctctgcctcagtttggcaaaaagtaa

KEGG   Homo sapiens (human): 548596Help
Entry
548596            CDS       T01001                                 

Gene name
CKMT1A, CKMT1, U-MtCK, mia-CK
Definition
(RefSeq) creatine kinase, mitochondrial 1A
  KO
K00933  creatine kinase [EC:2.7.3.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00330  Arginine and proline metabolism
hsa01100  Metabolic pathways
Module
hsa_M00047  Creatine pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    548596 (CKMT1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    548596 (CKMT1A)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.2  creatine kinase
     548596 (CKMT1A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   548596 (CKMT1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-gua_Ptrans ATP-gua_PtransN
Motif
Other DBs
NCBI-GeneID: 548596
NCBI-ProteinID: NP_001015001
OMIM: 613415
HGNC: 31736
Ensembl: ENSG00000223572
Vega: OTTHUMG00000059898
Pharos: P12532(Tbio)
UniProt: P12532
Structure
PDB: 

Position
15q15.3
AA seq 417 aa AA seqDB search
MAGPFSRLLSARPGLRLLALAGAGSLAAGFLLRPEPVRAASERRRLYPPSAEYPDLRKHN
NCMASHLTPAVYARLCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYEVFAD
LFDPVIQERHNGYDPRTMKHTTDLDASKIRSGYFDERYVLSSRVRTGRSIRGLSLPPACT
RAERREVERVVVDALSGLKGDLAGRYYRLSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGM
ARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQER
GWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDT
AATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLERGQDIRIPTPVIHTKH
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggctggtcccttctcccgtctgctgtccgcccgcccgggactcaggctcctggctttg
gccggagcggggtctctagccgctgggtttctgctccgaccggaacctgtacgagctgcc
agtgaacgacggaggctgtatcccccgagcgctgagtacccagacctccgaaagcacaac
aactgcatggccagtcacctgaccccagcagtctatgcacggctctgcgacaagaccaca
cccactggttggacgctagatcagtgtatccagactggcgtggacaaccctggccacccc
ttcatcaagactgtgggcatggtggctggagatgaggagacctatgaggtatttgctgac
ctgtttgaccctgtgatccaagagcgacacaatggatatgacccccggacaatgaagcac
accacggatctagatgccagtaaaatccgttctggctactttgatgagaggtatgtattg
tcctctagagtcagaactggccgaagcatccgaggactcagtctgcctccagcttgcact
cgagcagagcgacgagaggtggaacgtgttgtggtggatgcactgagtggcctgaagggt
gacctggctggacgttactataggctcagtgagatgacagaggctgaacagcagcagctt
attgatgaccactttctgtttgataagcctgtgtccccgttgctgactgcagcaggaatg
gctcgagactggccagatgctcgtggaatttggcacaacaatgagaagagcttcctgatc
tgggtgaatgaggaggatcatacacgggtgatctccatggagaagggtggtaacatgaag
agagtgtttgaaagattctgccgaggcctcaaagaggtggagagacttatccaagaacgt
ggctgggagttcatgtggaatgagcgtttgggatacatcttgacctgtccatctaacctg
ggcactggacttcgggcaggagtgcacatcaaactgcccctgctaagcaaagatagccgc
ttcccaaagatcctggagaacctaagactccaaaagcgtggtactggaggagtggacact
gctgccacaggcggtgtctttgatatttctaatttggaccgactaggcaaatcagaggtg
gagctggtgcaactggtcatcgatggagtaaactatttgattgattgtgaacggcgtctg
gagagaggccaggatatccgcatccccacacctgtcatccacaccaagcattaa

DBGET integrated database retrieval system