KEGG   Homo sapiens (human): 115201Help
Entry
115201            CDS       T01001                                 

Gene name
ATG4A, APG4A, AUTL2
Definition
(RefSeq) autophagy related 4A cysteine peptidase
  KO
K08342  cysteine protease ATG4 [EC:3.4.22.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04136  Autophagy - other
hsa04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    115201 (ATG4A)
   04136 Autophagy - other
    115201 (ATG4A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    115201 (ATG4A)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    115201 (ATG4A)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    115201 (ATG4A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     115201 (ATG4A)
Peptidases and inhibitors [BR:hsa01002]
 Cysteine peptidases
  Family C54: Aut2 peptidase family
   115201 (ATG4A)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    115201 (ATG4A)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    115201 (ATG4A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C54
Motif
Other DBs
NCBI-GeneID: 115201
NCBI-ProteinID: NP_443168
OMIM: 300663
HGNC: 16489
Ensembl: ENSG00000101844
Vega: OTTHUMG00000022176
Pharos: Q8WYN0(Tbio)
UniProt: Q8WYN0
Structure
PDB: 

Position
Xq22.3
AA seq 398 aa AA seqDB search
MESVLSKYEDQITIFTDYLEEYPDTDELVWILGKQHLLKTEKSKLLSDISARLWFTYRRK
FSPIGGTGPSSDAGWGCMLRCGQMMLAQALICRHLGRDWSWEKQKEQPKEYQRILQCFLD
RKDCCYSIHQMAQMGVGEGKSIGEWFGPNTVAQVLKKLALFDEWNSLAVYVSMDNTVVIE
DIKKMCRVLPLSADTAGDRPPDSLTASNQSKGTSAYCSAWKPLLLIVPLRLGINQINPVY
VDAFKECFKMPQSLGALGGKPNNAYYFIGFLGDELIFLDPHTTQTFVDTEENGTVNDQTF
HCLQSPQRMNILNLDPSVALGFFCKEEKDFDNWCSLVQKEILKENLRMFELVQKHPSHWP
PFVPPAKPEVTTTGAEFIDSTEQLEEFDLEEDFEILSV
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggagtcagttttatccaagtatgaagatcagattactattttcactgactacctagaa
gaatatccagatacagatgagctggtatggatcttagggaagcagcatctccttaaaaca
gaaaaatctaagctgttgtctgatataagtgctcgtctatggtttacatacagaaggaaa
ttttcaccaattggtggaacgggcccttcatcagatgctggttggggatgtatgctacgc
tgtggacagatgatgctggctcaagcccttatctgtagacacttgggaagggactggagc
tgggagaaacaaaaagaacaacccaaagaataccaacgcatcctacagtgcttcttagat
agaaaagattgttgctactctatccatcaaatggcacaaatgggtgtaggagaagggaaa
tcaattggagaatggtttggaccaaatacagttgcacaggtgttaaaaaaacttgcttta
tttgacgaatggaattccttggctgtttatgtttcaatggataacacagtggtcattgaa
gatatcaaaaaaatgtgccgtgtccttcccttgagtgctgacacagctggtgacaggcct
cccgattctttaactgcttcaaaccagagtaagggcacctctgcctactgctcagcctgg
aaacccctgctgctcattgtgccccttcgcctgggcataaaccaaatcaatcctgtctat
gttgatgcattcaaagagtgttttaagatgccacagtctttaggggcattaggaggaaaa
ccaaataacgcgtattatttcataggattcttaggtgacgagctcatcttcttggaccct
catacaacccagacctttgttgacactgaagagaatggaacggttaatgaccagactttc
cattgcctgcagtccccacagcgaatgaacatcctaaacctggatccttcagttgcattg
ggatttttctgcaaagaagaaaaagactttgataactggtgtagccttgttcagaaggaa
attctaaaggagaatttaaggatgtttgaattagttcagaaacatccatcacactggcct
ccctttgtacctccagccaagccagaagtgacaaccactggggcagaattcattgactct
actgagcaactggaggagtttgatctggaggaagattttgagattctgagtgtgtag

KEGG   Homo sapiens (human): 23192Help
Entry
23192             CDS       T01001                                 

Gene name
ATG4B, APG4B, AUTL1
Definition
(RefSeq) autophagy related 4B cysteine peptidase
  KO
K08342  cysteine protease ATG4 [EC:3.4.22.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04136  Autophagy - other
hsa04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    23192 (ATG4B)
   04136 Autophagy - other
    23192 (ATG4B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    23192 (ATG4B)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    23192 (ATG4B)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    23192 (ATG4B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     23192 (ATG4B)
Peptidases and inhibitors [BR:hsa01002]
 Cysteine peptidases
  Family C54: Aut2 peptidase family
   23192 (ATG4B)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    23192 (ATG4B)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    23192 (ATG4B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C54
Motif
Other DBs
NCBI-GeneID: 23192
NCBI-ProteinID: NP_037457
OMIM: 611338
HGNC: 20790
Ensembl: ENSG00000168397
Vega: OTTHUMG00000151514
Pharos: Q9Y4P1(Tbio)
UniProt: Q9Y4P1 B3KVU2
Structure
PDB: 

Position
2q37.3
AA seq 393 aa AA seqDB search
MDAATLTYDTLRFAEFEDFPETSEPVWILGRKYSIFTEKDEILSDVASRLWFTYRKNFPA
IGGTGPTSDTGWGCMLRCGQMIFAQALVCRHLGRDWRWTQRKRQPDSYFSVLNAFIDRKD
SYYSIHQIAQMGVGEGKSIGQWYGPNTVAQVLKKLAVFDTWSSLAVHIAMDNTVVMEEIR
RLCRTSVPCAGATAFPADSDRHCNGFPAGAEVTNRPSPWRPLVLLIPLRLGLTDINEAYV
ETLKHCFMMPQSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQPAVEPTDGCFIPDESFH
CQHPPCRMSIAELDPSIAVGFFCKTEDDFNDWCQQVKKLSLLGGALPMFELVELQPSHLA
CPDVLNLSLDSSDVERLERFFDSEDEDFEILSL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggacgcagctactctgacctacgacactctccggtttgctgagtttgaagattttcct
gagacctcagagcccgtttggatactgggtagaaaatacagcattttcacagaaaaggac
gagatcttgtctgatgtggcatctagactttggtttacatacaggaaaaactttccagcc
attggggggacaggccccacctcggacacaggctggggctgcatgctgcggtgtggacag
atgatctttgcccaagccctggtgtgccggcacctaggccgagattggaggtggacacaa
aggaagaggcagccagacagctacttcagcgtcctcaacgcattcatcgacaggaaggac
agttactactccattcaccagatagcgcaaatgggagttggcgaaggcaagtccataggc
cagtggtacgggcccaacactgtcgcccaggtcctgaagaagcttgctgtcttcgatacg
tggagctccttggcggtccacattgcaatggacaacactgttgtgatggaggaaatcaga
aggttgtgcaggaccagcgttccctgtgcaggcgccactgcgtttcctgcagattccgac
cggcactgcaacggattccctgccggagctgaggtcaccaacaggccgtcgccatggaga
cccctggtacttctcattcccctgcgcctggggctcacggacatcaacgaggcctacgtg
gagacgctgaagcactgcttcatgatgccccagtccctgggcgtcatcggagggaagccc
aacagcgcccactacttcatcggctacgttggtgaggagctcatctacctggacccccac
accacgcagccagccgtggagcccactgatggctgcttcatcccggacgagagcttccac
tgccagcacccgccgtgccgcatgagcatcgcggagcttgacccgtccatcgctgtgggg
tttttctgtaagactgaagatgacttcaatgattggtgccagcaagtcaaaaagctgtct
ctgcttggaggtgccctgcccatgtttgagctggtggagctgcagccttcacatctggcc
tgccccgacgtcctgaacctgtccctagattcttctgatgtagagcgactggaaagattc
ttcgactcagaagatgaagactttgaaatcctgtccctttga

KEGG   Homo sapiens (human): 84938Help
Entry
84938             CDS       T01001                                 

Gene name
ATG4C, APG4-C, APG4C, AUTL1, AUTL3
Definition
(RefSeq) autophagy related 4C cysteine peptidase
  KO
K08342  cysteine protease ATG4 [EC:3.4.22.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04136  Autophagy - other
hsa04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    84938 (ATG4C)
   04136 Autophagy - other
    84938 (ATG4C)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    84938 (ATG4C)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    84938 (ATG4C)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    84938 (ATG4C)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     84938 (ATG4C)
Peptidases and inhibitors [BR:hsa01002]
 Cysteine peptidases
  Family C54: Aut2 peptidase family
   84938 (ATG4C)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    84938 (ATG4C)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    84938 (ATG4C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C54
Motif
Other DBs
NCBI-GeneID: 84938
NCBI-ProteinID: NP_116241
OMIM: 611339
HGNC: 16040
Ensembl: ENSG00000125703
Vega: OTTHUMG00000009142
Pharos: Q96DT6(Tbio)
UniProt: Q96DT6 A0A384MTY5
Position
1p31.3
AA seq 458 aa AA seqDB search
MEATGTDEVDKLKTKFISAWNNMKYSWVLKTKTYFSRNSPVLLLGKCYHFKYEDEDKTLP
AESGCTIEDHVIAGNVEEFRKDFISRIWLTYREEFPQIEGSALTTDCGWGCTLRTGQMLL
AQGLILHFLGRAWTWPDALNIENSDSESWTSHTVKKFTASFEASLSGEREFKTPTISLKE
TIGKYSDDHEMRNEVYHRKIISWFGDSPLALFGLHQLIEYGKKSGKKAGDWYGPAVVAHI
LRKAVEEARHPDLQGITIYVAQDCTVYNSDVIDKQSASMTSDNADDKAVIILVPVRLGGE
RTNTDYLEFVKGILSLEYCVGIIGGKPKQSYYFAGFQDDSLIYMDPHYCQSFVDVSIKDF
PLETFHCPSPKKMSFRKMDPSCTIGFYCRNVQDFKRASEEITKMLKFSSKEKYPLFTFVN
GHSRDYDFTSTTTNEEDLFSEDEKKQLKRFSTEEFVLL
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggaggctacaggaacagatgaagttgacaagctaaaaaccaaatttatatctgcttgg
aacaacatgaaatatagttgggtgttgaaaacaaagacgtattttagtagaaattctcct
gtattattgcttggaaaatgttaccattttaaatatgaagatgaagataaaacgttacct
gcagagtcgggatgtacaatagaggatcacgtaattgcaggaaatgtagaagaatttcgt
aaagatttcatttctagaatatggctgacctacagggaagaattccctcaaatagaaggc
tcagctttgacaacagactgtgggtggggctgcacattgagaactggccagatgctcttg
gctcaaggactcatactacactttcttggtagagcttggacctggcctgatgctttgaat
attgaaaattcagactctgaatcatggacttcccacactgtcaaaaaatttactgcatca
tttgaagcatcactttcaggggaaagagaattcaaaaccccaacaatttctctgaaggaa
acaattgggaaatattctgatgatcatgaaatgcgaaatgaagtttatcataggaaaatc
atctcttggtttggtgattcccccttggctctttttggcttacatcaactaatagaatat
ggaaagaagtctgggaaaaaagcaggagattggtatggaccagctgtggttgctcacatt
ttaagaaaagcagttgaagaagcaaggcatcctgatttacaaggaataactatttatgtt
gcacaagattgtacagtttacaattctgatgtaattgataaacagagtgcttccatgact
tctgataatgcagatgacaaagctgttattattctagttcctgttagacttggtggagaa
agaaccaacaccgactacttagaatttgtgaagggtattttaagcctggaatattgtgtg
ggtattattggtggcaaacctaaacagtcatattactttgctggatttcaagatgacagt
ttgatttacatggatcctcattactgccaatcttttgtagatgtcagcataaaggatttc
cctcttgagacattccactgcccttctcccaaaaagatgtcttttcgaaaaatggatccc
agctgtacaataggattttactgtcgaaatgttcaggacttcaaacgagcttctgaagaa
atcaccaagatgctgaaattttcttctaaggagaaatatcccttatttacttttgtaaat
ggtcattccagagactatgattttacatctactacaaccaatgaagaagaccttttttca
gaggatgaaaagaaacaattaaaaagatttagcacggaagagtttgtcttgctttaa

KEGG   Homo sapiens (human): 84971Help
Entry
84971             CDS       T01001                                 

Gene name
ATG4D, APG4-D, APG4D, AUTL4
Definition
(RefSeq) autophagy related 4D cysteine peptidase
  KO
K08342  cysteine protease ATG4 [EC:3.4.22.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04136  Autophagy - other
hsa04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    84971 (ATG4D)
   04136 Autophagy - other
    84971 (ATG4D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    84971 (ATG4D)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    84971 (ATG4D)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    84971 (ATG4D)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     84971 (ATG4D)
Peptidases and inhibitors [BR:hsa01002]
 Cysteine peptidases
  Family C54: Aut2 peptidase family
   84971 (ATG4D)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    84971 (ATG4D)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    84971 (ATG4D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C54
Motif
Other DBs
NCBI-GeneID: 84971
NCBI-ProteinID: NP_116274
OMIM: 611340
HGNC: 20789
Ensembl: ENSG00000130734
Vega: OTTHUMG00000180582
Pharos: Q86TL0(Tbio)
UniProt: Q86TL0
Position
19p13.2
AA seq 474 aa AA seqDB search
MNSVSPAAAQYRSSSPEDARRRPEARRPRGPRGPDPNGLGPSGASGPALGSPGAGPSEPD
EVDKFKAKFLTAWNNVKYGWVVKSRTSFSKISSIHLCGRRYRFEGEGDIQRFQRDFVSRL
WLTYRRDFPPLPGGCLTSDCGWGCMLRSGQMMLAQGLLLHFLPRDWTWAEGMGLGPPELS
GSASPSRYHGPARWMPPRWAQGAPELEQERRHRQIVSWFADHPRAPFGLHRLVELGQSSG
KKAGDWYGPSLVAHILRKAVESCSDVTRLVVYVSQDCTVYKADVARLVARPDPTAEWKSV
VILVPVRLGGETLNPVYVPCVKELLRCELCLGIMGGKPRHSLYFIGYQDDFLLYLDPHYC
QPTVDVSQADFPLESFHCTSPRKMAFAKMDPSCTVGFYAGDRKEFETLCSELTRVLSSSS
ATERYPMFTLAEGHAQDHSLDDLCSQLAQPTLRLPRTGRLLRAKRPSSEDFVFL
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgaactcagtgtcgccggccgccgcgcagtaccggagcagcagcccggaggacgcgcgc
cgccggcccgaggcccgcaggccgcggggtcccagaggcccagaccccaacggcctgggg
ccttccggagccagcggccccgctcttggctctcccggggctggcccgagtgagccggac
gaagtggacaagttcaaggccaagttcctgacagcctggaacaacgtcaagtacggttgg
gtggttaaaagccggaccagctttagcaagatctccagcatccacctctgtggccgccgc
taccgtttcgagggcgagggtgacatacagcgtttccagcgggactttgtgtcccgcctg
tggctcacataccgccgggacttcccgccccttcctgggggctgcctgacctcggactgt
ggctgggggtgcatgttacgcagcggccagatgatgctggcacagggccttctgctgcat
ttcctgcccagagactggacatgggccgagggcatgggcctgggcccccctgagctgtca
gggtcagcctctcccagccggtaccatgggcctgcccgctggatgcccccacgctgggcc
cagggtgcccctgagctggagcaggaacgccggcaccggcagattgtgtcctggttcgcc
gaccacccccgggccccctttggcctacaccggctggtggagcttgggcagagctcaggc
aagaaggcaggtgactggtatgggccatcgctagtggcacacatcctcaggaaagccgtg
gagagctgctccgacgtcacccgcctggtggtgtacgtttctcaggactgcacagtgtac
aaggcggatgtggcacgcctggtggccaggccagaccccacagccgagtggaagtctgtg
gtcatcctggtgcccgtgcgactgggtggcgagactctcaaccccgtgtatgtgccctgc
gtgaaggaactcctgcgttgcgagctgtgcctgggcatcatgggtgggaaaccgcgacac
tcactgtacttcattggctaccaagatgacttcctgctgtacctggaccctcactactgc
cagcccactgtggatgtcagccaggccgacttccccctggagtccttccactgcacctcg
ccccgcaagatggcctttgccaagatggacccaagctgtaccgtgggcttctatgctgga
gacaggaaggagtttgagacactctgctcagagctgaccagggtcctcagctcctcctca
gccacagagcggtaccccatgttcaccctggccgagggccatgctcaggaccacagcctg
gacgacctctgctcccagctcgcccagcccacactccggctccctcgcacagggcggctc
ctcagggccaaacgccccagctctgaggactttgtgtttttataa

DBGET integrated database retrieval system