KEGG   Homo sapiens (human): 115209
Entry
115209            CDS       T01001                                 

Gene name
OMA1, 2010001O09Rik, DAB1, MPRP-1, MPRP1, YKR087C, ZMPOMA1, peptidase
Definition
(RefSeq) OMA1 zinc metallopeptidase
  KO
K23010  metalloendopeptidase OMA1, mitochondrial [EC:3.4.24.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05017  Spinocerebellar ataxia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    115209 (OMA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    115209 (OMA1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     115209 (OMA1)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M48: Ste24 endopeptidase family
   115209 (OMA1)
SSDB
Motif
Pfam: Peptidase_M48 DUF5572
Other DBs
NCBI-GeneID: 115209
NCBI-ProteinID: NP_660286
OMIM: 617081
HGNC: 29661
Ensembl: ENSG00000162600
Vega: OTTHUMG00000010068
Pharos: Q96E52(Tbio)
UniProt: Q96E52
Position
1p32.2-p32.1
AA seq 524 aa
MSFICGLQSAARNHVFFRFNSLSNWRKCNTLASTSRGCHQVQVNHIVNKYQGLGVNQCDR
WSFLPGNFHFYSTFNNKRTGGLSSTKSKEIWRITSKCTVWNDAFSRQLLIKEVTAVPSLS
VLHPLSPASIRAIRNFHTSPRFQAAPVPLLLMILKPVQKLFAIIVGRGIRKWWQALPPNK
KEVVKENIRKNKWKLFLGLSSFGLLFVVFYFTHLEVSPITGRSKLLLLGKEQFRLLSELE
YEAWMEEFKNDMLTEKDARYLAVKEVLCHLIECNKDVPGISQINWVIHVVDSPIINAFVL
PNGQMFVFTGFLNSVTDIHQLSFLLGHEIAHAVLGHAAEKAGMVHLLDFLGMIFLTMIWA
ICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACADIRASSVFWQQM
EFVDSLHGQPKMPEWLSTHPSHGNRVEYLDRLIPQALKIREMCNCPPLSNPDPRLLFKLS
TKHFLEESEKEDLNITKKQKMDTLPIQKQEQIPLTYIVEKRTGS
NT seq 1575 nt   +upstreamnt  +downstreamnt
atgagcttcatctgtggattgcagtctgctgctagaaaccatgttttcttccgatttaat
tcactgtctaactggagaaaatgtaacacattagcatccacctcacggggctgtcatcaa
gtacaagttaaccatatagtaaataagtatcagggactgggagtaaatcagtgtgacagg
tggagttttctgcctggaaactttcatttttatagtacttttaacaacaaaagaacagga
ggcctctcaagtaccaaaagtaaggaaatttggaggattaccagcaaatgtactgtatgg
aatgatgctttttcaagacagctgctaataaaagaagttacagcagtccctagtctgtca
gtattgcatcctctaagccctgcttccataagagctattaggaatttccatacttctcca
cggtttcaagctgctccggttcctctcttgttgatgattcttaaaccagtacagaagtta
tttgcaatcattgtaggcaggggcataaggaaatggtggcaggcacttcctcctaacaag
aaggaagtagttaaagaaaatataaggaagaataaatggaagctattccttggtttgagt
agttttggattgctctttgtggtgttttattttactcacctggaagtaagtccaatcaca
ggaaggagcaagctactattattggggaaagaacagttcagacttttatcggaactggaa
tatgaagcatggatggaagaatttaaaaatgatatgctaactgagaaagatgcccgatac
ctggctgttaaagaagtgctttgtcatctaattgaatgcaataaagatgttccagggatc
tctcagatcaattgggttattcatgtggttgattccccaattattaatgccttcgtgctt
ccaaatggacaaatgtttgttttcactggatttttaaatagtgtaaccgatattcatcaa
ctttctttccttctgggccatgaaatagcacatgcagtacttgggcatgctgcagaaaag
gctggcatggttcatttgttggatttcctaggtatgattttcctcacaatgatttgggcc
atttgtcctcgagatagcttggcacttttgtgccagtggatacagtctaaattgcaggag
tatatgtttaatagaccatacagcagaaaattggaggccgaagctgacaaaattggacta
ctgcttgctgcaaaggcttgtgcagacataagagccagttcagtgttttggcagcaaatg
gagttcgttgatagcctgcatggccaacccaagatgccagaatggttatctacacaccct
tctcatggcaatcgagttgagtacttggatagacttatacctcaggctctcaaaattaga
gagatgtgtaattgtccaccactgtctaatccagaccctcgattactattcaaactcagc
acgaagcattttcttgaagaatcagagaaagaagacctaaatatcacgaagaaacagaaa
atggatactcttcctattcaaaaacaggagcaaataccattaacatacatagttgagaaa
agaacgggcagttga

DBGET integrated database retrieval system