KEGG   Homo sapiens (human): 115273Help
Entry
115273            CDS       T01001                                 

Gene name
RAB42
Definition
(RefSeq) RAB42, member RAS oncogene family
  KO
K07929  Ras-related protein Rab-42
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    115273 (RAB42)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab39/42 [OT]
    115273 (RAB42)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA SRPRB LigB CENP-M Ser_hydrolase GTP_EFTU ArsB
Motif
Other DBs
NCBI-GeneID: 115273
NCBI-ProteinID: NP_001180461
HGNC: 28702
Ensembl: ENSG00000188060
Vega: OTTHUMG00000003656
Pharos: Q8N4Z0(Tdark)
UniProt: Q8N4Z0
Position
1p35.3
AA seq 218 aa AA seqDB search
MEAEGCRYQFRVALLGDAAVGKTSLLRSYVAGAPGAPEPEPEPEPTVGAECYRRALQLRA
GPRVKLQLWDTAGHERFRCITRSFYRNVVGVLLVFDVTNRKSFEHIQDWHQEVMATQGPD
KVIFLLVGHKSDLQSTRCVSAQEAEELAASLGMAFVETSVKNNCNVDLAFDTLADAIQQA
LQQGDIKLEEGWGGVRLIHKTQIPRSPSRKQHSGPCQC
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggaggccgagggctgccgctaccaatttcgggtcgcgctgctgggggacgcggcggtg
ggcaagacgtcgctgctgcggagctacgtggcaggcgcgcctggcgccccggagccggag
cccgagcccgagcccacggtgggcgccgagtgctaccgccgcgcgctgcagctgcgggcc
gggccgcgggtcaagctgcaactctgggacaccgcgggccacgagcgcttcaggtgcatc
accaggtccttttaccggaatgtggtgggtgtcctgctggtctttgatgtgacaaacagg
aagtcctttgaacacatccaagactggcaccaggaggtcatggccactcagggcccggac
aaggtcatcttcctgctggttggccacaagagtgacctgcagagcacccgctgtgtctca
gcccaggaggccgaggagctagctgcctccctgggcatggccttcgtggagacctcggtt
aaaaacaactgcaatgtggacctggcctttgacaccctcgctgatgctatccagcaggcc
ctgcagcagggggacatcaagctagaagagggctgggggggtgtccggctcatccacaag
acccaaatccccaggtcccccagcaggaagcagcactcaggcccatgccagtgttga

DBGET integrated database retrieval system