KEGG   Homo sapiens (human): 115286
Entry
115286            CDS       T01001                                 

Gene name
SLC25A26, COXPD28, SAMC
Definition
(RefSeq) solute carrier family 25 member 26
  KO
K15111  solute carrier family 25 (mitochondrial S-adenosylmethionine transporter), member 26
Organism
hsa  Homo sapiens (human)
Disease
H00891  Combined oxidative phosphorylation deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    115286 (SLC25A26)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   115286 (SLC25A26)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 115286
NCBI-ProteinID: NP_775742
OMIM: 611037
HGNC: 20661
Ensembl: ENSG00000144741
Pharos: Q70HW3(Tbio)
UniProt: Q70HW3
Position
3p14.1
AA seq 274 aa
MDRPGFVAALVAGGVAGVSVDLILFPLDTIKTRLQSPQGFSKAGGFHGIYAGVPSAAIGS
FPNAAAFFITYEYVKWFLHADSSSYLTPMKHMLAASAGEVVACLIRVPSEVVKQRAQVSA
STRTFQIFSNILYEEGIQGLYRGYKSTVLREIPFSLVQFPLWESLKALWSWRQDHVVDSW
QSAVCGAFAGGFAAAVTTPLDVAKTRITLAKAGSSTADGNVLSVLHGVWRSQGLAGLFAG
VFPRMAAISLGGFIFLGAYDRTHSLLLEVGRKSP
NT seq 825 nt   +upstreamnt  +downstreamnt
atggaccggccggggttcgtggcagcgctggtggctggtggggtagcaggtgtttctgtt
gacttgatattatttcctctggataccattaaaaccaggctgcagagtccccaaggattt
agtaaggctggtggttttcatggaatatatgctggcgttccttctgctgctattggatcc
tttcctaatgctgctgcattttttatcacctatgaatatgtgaagtggtttttgcatgct
gattcatcttcatatttgacacctatgaaacatatgttggctgcctctgctggagaagtg
gttgcctgcctgattcgagttccatctgaagtggttaagcagagggcacaggtatctgct
tctacaagaacatttcagattttctctaacatcttatatgaagagggtatccaagggttg
tatcgaggctataaaagcacagttttaagagagattcctttttctttggtccagtttccc
ttatgggagtccttaaaagccctctggtcctggaggcaggatcatgtggtggattcttgg
cagtcagcagtctgtggagcttttgcaggtggatttgccgctgcagtcaccacccctcta
gacgtggcaaagacaagaattacgctggcaaaggctggctccagcactgctgatgggaat
gtgctctctgtcctgcatggggtctggcggtcacaggggctggcaggattatttgcaggt
gtcttccctcgaatggcagccatcagtctgggaggtttcatctttctgggggcttatgac
cgaacgcacagcttgctgttggaagttggcagaaagagtccttga

DBGET integrated database retrieval system