KEGG   Homo sapiens (human): 115352Help
Entry
115352            CDS       T01001                                 

Gene name
FCRL3, CD307c, FCRH3, IFGP3, IRTA3, SPAP2
Definition
(RefSeq) Fc receptor like 3
  KO
K06727  Fc receptor-like protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    115352 (FCRL3)
CD molecules [BR:hsa04090]
 Proteins
  115352 (FCRL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_2 Ig_3 ig Ig_C17orf99 I-set V-set V-set_CD47 C2-set_2 PGBA_C
Motif
Other DBs
NCBI-GeneID: 115352
NCBI-ProteinID: NP_443171
OMIM: 606510
HGNC: 18506
Ensembl: ENSG00000160856
Vega: OTTHUMG00000019400
Pharos: Q96P31(Tbio)
UniProt: Q96P31
Position
1q23.1
AA seq 734 aa AA seqDB search
MLLWLLLLILTPGREQSGVAPKAVLLLNPPWSTAFKGEKVALICSSISHSLAQGDTYWYH
DEKLLKIKHDKIQITEPGNYQCKTRGSSLSDAVHVEFSPDWLILQALHPVFEGDNVILRC
QGKDNKNTHQKVYYKDGKQLPNSYNLEKITVNSVSRDNSKYHCTAYRKFYILDIEVTSKP
LNIQVQELFLHPVLRASSSTPIEGSPMTLTCETQLSPQRPDVQLQFSLFRDSQTLGLGWS
RSPRLQIPAMWTEDSGSYWCEVETVTHSIKKRSLRSQIRVQRVPVSNVNLEIRPTGGQLI
EGENMVLICSVAQGSGTVTFSWHKEGRVRSLGRKTQRSLLAELHVLTVKESDAGRYYCAA
DNVHSPILSTWIRVTVRIPVSHPVLTFRAPRAHTVVGDLLELHCESLRGSPPILYRFYHE
DVTLGNSSAPSGGGASFNLSLTAEHSGNYSCDADNGLGAQHSHGVSLRVTVPVSRPVLTL
RAPGAQAVVGDLLELHCESLRGSFPILYWFYHEDDTLGNISAHSGGGASFNLSLTTEHSG
NYSCEADNGLGAQHSKVVTLNVTGTSRNRTGLTAAGITGLVLSILVLAAAAALLHYARAR
RKPGGLSATGTSSHSPSECQEPSSSRPSRIDPQEPTHSKPLAPMELEPMYSNVNPGDSNP
IYSQIWSIQHTKENSANCPMMHQEHEELTVLYSELKKTHPDDSAGEASSRGRAHEEDDEE
NYENVPRVLLASDH
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgcttctgtggctgctgctgctgatcctgactcctggaagagaacaatcaggggtggcc
ccaaaagctgtacttctcctcaatcctccatggtccacagccttcaaaggagaaaaagtg
gctctcatatgcagcagcatatcacattccctagcccagggagacacatattggtatcac
gatgagaagttgttgaaaataaaacatgacaagatccaaattacagagcctggaaattac
caatgtaagacccgaggatcctccctcagtgatgccgtgcatgtggaattttcacctgac
tggctgatcctgcaggctttacatcctgtctttgaaggagacaatgtcattctgagatgt
caggggaaagacaacaaaaacactcatcaaaaggtttactacaaggatggaaaacagctt
cctaatagttataatttagagaagatcacagtgaattcagtctccagggataatagcaaa
tatcattgtactgcttataggaagttttacatacttgacattgaagtaacttcaaaaccc
ctaaatatccaagttcaagagctgtttctacatcctgtgctgagagccagctcttccacg
cccatagaggggagtcccatgaccctgacctgtgagacccagctctctccacagaggcca
gatgtccagctgcaattctccctcttcagagatagccagaccctcggattgggctggagc
aggtcccccagactccagatccctgccatgtggactgaagactcagggtcttactggtgt
gaggtggagacagtgactcacagcatcaaaaaaaggagcctgagatctcagatacgtgta
cagagagtccctgtgtctaatgtgaatctagagatccggcccaccggagggcagctgatt
gaaggagaaaatatggtccttatttgctcagtagcccagggttcagggactgtcacattc
tcctggcacaaagaaggaagagtaagaagcctgggtagaaagacccagcgttccctgttg
gcagagctgcatgttctcaccgtgaaggagagtgatgcagggagatactactgtgcagct
gataacgttcacagccccatcctcagcacgtggattcgagtcaccgtgagaattccggta
tctcaccctgtcctcaccttcagggctcccagggcccacactgtggtgggggacctgctg
gagcttcactgtgagtccctgagaggctctcccccgatcctgtaccgattttatcatgag
gatgtcaccctggggaacagctcagccccctctggaggaggagcctccttcaacctctct
ctgactgcagaacattctggaaactactcctgtgatgcagacaatggcctgggggcccag
cacagtcatggagtgagtctcagggtcacagttccggtgtctcgccccgtcctcaccctc
agggctcccggggcccaggctgtggtgggggacctgctggagcttcactgtgagtccctg
agaggctccttcccgatcctgtactggttttatcacgaggatgacaccttggggaacatc
tcggcccactctggaggaggggcatccttcaacctctctctgactacagaacattctgga
aactactcatgtgaggctgacaatggcctgggggcccagcacagtaaagtggtgacactc
aatgttacaggaacttccaggaacagaacaggccttaccgctgcgggaatcacggggctg
gtgctcagcatcctcgtccttgctgctgctgctgctctgctgcattacgccagggcccga
aggaaaccaggaggactttctgccactggaacatctagtcacagtcctagtgagtgtcag
gagccttcctcgtccaggccttccaggatagaccctcaagagcccactcactctaaacca
ctagccccaatggagctggagccaatgtacagcaatgtaaatcctggagatagcaacccg
atttattcccagatctggagcatccagcatacaaaagaaaactcagctaattgtccaatg
atgcatcaagagcatgaggaacttacagtcctctattcagaactgaagaagacacaccca
gacgactctgcaggggaggctagcagcagaggcagggcccatgaagaagatgatgaagaa
aactatgagaatgtaccacgtgtattactggcctcagaccactag

DBGET integrated database retrieval system