KEGG   Homo sapiens (human): 115361
Entry
115361            CDS       T01001                                 

Gene name
GBP4, Mpa2
Definition
(RefSeq) guanylate binding protein 4
  KO
K20899  guanylate-binding protein 1/3/4/7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    115361 (GBP4)
SSDB
Motif
Pfam: GBP_C GBP MMR_HSR1
Other DBs
NCBI-GeneID: 115361
NCBI-ProteinID: NP_443173
OMIM: 612466
HGNC: 20480
Ensembl: ENSG00000162654
Vega: OTTHUMG00000010663
Pharos: Q96PP9(Tbio)
UniProt: Q96PP9
Position
1p22.2
AA seq 640 aa
MGERTLHAAVPTPGYPESESIMMAPICLVENQEEQLTVNSKALEILDKISQPVVVVAIVG
LYRTGKSYLMNRLAGKRNGFPLGSTVQSETKGIWMWCVPHLSKPNHTLVLLDTEGLGDVE
KSNPKNDSWIFALAVLLSSSFVYNSVSTINHQALEQLHYVTELAELIRAKSCPRPDEAED
SSEFASFFPDFIWTVRDFTLELKLDGNPITEDEYLENALKLIPGKNPKIQNSNMPRECIR
HFFRKRKCFVFDRPTNDKQYLNHMDEVPEENLERHFLMQSDNFCSYIFTHAKTKTLREGI
IVTGKRLGTLVVTYVDAINSGAVPCLENAVTALAQLENPAAVQRAADHYSQQMAQQLRLP
TDTLQELLDVHAACEREAIAVFMEHSFKDENHEFQKKLVDTIEKKKGDFVLQNEEASAKY
CQAELKRLSEHLTESILRGIFSVPGGHNLYLEEKKQVEWDYKLVPRKGVKANEVLQNFLQ
SQVVVEESILQSDKALTAGEKAIAAERAMKEAAEKEQELLREKQKEQQQMMEAQERSFQE
YMAQMEKKLEEERENLLREHERLLKHKLKVQEEMLKEEFQKKSEQLNKEINQLKEKIEST
KNEQLRLLKILDMASNIMIVTLPGASKLLGVGTKYLGSRI
NT seq 1923 nt   +upstreamnt  +downstreamnt
atgggtgagagaactcttcacgctgcagtgcccacaccaggttatccagaatctgaatcc
atcatgatggcccccatttgtctagtggaaaaccaggaagagcagctgacagtgaattca
aaggcattagagattcttgacaagatttctcagcccgtggtggtggtggccattgtaggg
ctataccgcacaggaaaatcctatctcatgaatcgtcttgcaggaaagcgcaatggcttc
cctctgggctccacggtgcagtctgaaactaagggcatctggatgtggtgtgtgccccac
ctctctaagccaaaccacaccctggtccttctggacaccgagggcctgggcgatgtagaa
aagagtaaccctaagaatgactcgtggatctttgccctggctgtgcttctaagcagcagc
tttgtctataacagcgtgagcaccatcaaccaccaggccctggagcagctgcactatgtg
actgagctagcagagctaatcagggcaaaatcctgccccagacctgatgaagctgaggac
tccagcgagtttgcgagtttctttccagactttatttggactgttcgggattttaccctg
gagctaaagttagatggaaaccccatcacagaagatgagtacctggagaatgccttgaag
ctgattccaggcaagaatcccaaaattcaaaattcaaacatgcctagagagtgtatcagg
catttcttccgaaaacggaagtgctttgtctttgaccggcctacaaatgacaagcaatat
ttaaatcatatggacgaagtgccagaagaaaatctggaaaggcatttccttatgcaatca
gacaacttctgttcttatatcttcacccatgcaaagaccaagaccctgagagagggaatc
attgtcactggaaagcggctggggactctggtggtgacttatgtagatgccatcaacagt
ggagcagtaccttgtctggagaatgcagtgacagcactggcccagcttgagaacccagcg
gctgtgcagagggcagccgaccactatagccagcagatggcccagcaactgaggctcccc
acagacacgctccaggagctgctggacgtgcatgcagcctgtgagagggaagccattgca
gtcttcatggagcactccttcaaggatgaaaaccatgaattccagaagaagcttgtggac
accatagagaaaaagaagggagactttgtgctgcagaatgaagaggcatctgccaaatat
tgccaggctgagcttaagcggctttcagagcacctgacagaaagcattttgagaggaatt
ttctctgttcctggaggacacaatctctacttagaagaaaagaaacaggttgagtgggac
tataagctagtgcccagaaaaggagttaaggcaaacgaggtcctccagaacttcctgcag
tcacaggtggttgtagaggaatccatcctgcagtcagacaaagccctcactgctggagag
aaggccatagcagcggagcgggccatgaaggaagcagctgagaaggaacaggagctgcta
agagaaaaacagaaggagcagcagcaaatgatggaggctcaagagagaagcttccaggaa
tacatggcccaaatggagaagaagttggaggaggaaagggaaaaccttctcagagagcat
gaaaggctgctaaaacacaagctgaaggtacaagaagaaatgcttaaggaagaatttcaa
aagaaatctgagcagttaaataaagagattaatcaactgaaagaaaaaattgaaagcact
aaaaatgaacagttaaggctcttaaagatccttgacatggctagcaacataatgattgtc
actctacctggggcttccaagctacttggagtagggacaaaatatcttggctcacgtatt
taa

DBGET integrated database retrieval system