KEGG   Homo sapiens (human): 115416Help
Entry
115416            CDS       T01001                                 

Gene name
MALSU1, C7orf30, mtRsfA
Definition
(RefSeq) mitochondrial assembly of ribosomal large subunit 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: RsfS
Motif
Other DBs
NCBI-GeneID: 115416
NCBI-ProteinID: NP_612455
OMIM: 614624
HGNC: 21721
Ensembl: ENSG00000156928
Vega: OTTHUMG00000128443
Pharos: Q96EH3(Tbio)
UniProt: Q96EH3
Structure
PDB: 

Position
7p15.3
AA seq 234 aa AA seqDB search
MGPGGRVARLLAPLMWRRAVSSVAGSAVGAEPGLRLLAVQRLPVGAAFCRACQTPNFVRG
LHSEPGLEERAEGTVNEGRPESDAADHTGPKFDIDMMVSLLRQENARDICVIQVPPEMRY
TDYFVIVSGTSTRHLHAMAFYVVKMYKHLKCKRDPHVKIEGKDTDDWLCVDFGSMVIHLM
LPETREIYELEKLWTLRSYDDQLAQIAPETVPEDFILGIEDDTSSVTPVELKCE
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggggccgggcggccgtgtggcgcggctgctcgccccactaatgtggcgcagggcggtt
tcctcggtggcggggtccgcggttggagccgagcccgggcttcggctgctggccgtgcag
cggcttcccgtaggagcagcgttctgccgggcttgccagaccccaaactttgtccgcggc
ctgcacagcgagcctgggctggaggagcgggcggaggggacggtcaacgagggacgccca
gaatcggacgcggcagatcatactggtcccaagtttgacatcgatatgatggtttcactt
ctgaggcaagaaaatgcaagagacatttgtgtgatccaggttcctccagaaatgagatat
acagattactttgtgattgttagtggaacttctacccgacacttacatgccatggccttc
tacgttgtgaaaatgtacaaacacctgaaatgtaaacgtgaccctcatgttaagatagaa
gggaaggacactgatgactggctgtgcgtggattttggcagcatggtgattcatttgatg
cttccagaaaccagagaaatctatgaattagagaaattatggaccctacgttcttatgat
gaccagttagctcagatagcacctgagacagtacctgaagacttcattcttggaatagaa
gatgatacttcatctgtgactccagtggagttaaaatgtgaataa

DBGET integrated database retrieval system