KEGG   Homo sapiens (human): 115509Help
Entry
115509            CDS       T01001                                 

Gene name
ZNF689, TIPUH1
Definition
(RefSeq) zinc finger protein 689
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    115509 (ZNF689)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    115509 (ZNF689)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Other Cys2His2 zinc factors
    115509 (ZNF689)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf_UBZ zf-C2H2_jaz Zn-ribbon_8 zf-met zf-C2H2_6 zf-C2H2_11 zf-C2HC_2 DUF3268
Motif
Other DBs
NCBI-GeneID: 115509
NCBI-ProteinID: NP_612456
OMIM: 618033
HGNC: 25173
Ensembl: ENSG00000156853
Vega: OTTHUMG00000132415
Pharos: Q96CS4(Tdark)
UniProt: Q96CS4
Position
16p11.2
AA seq 500 aa AA seqDB search
MAPPSAPLPAQGPGKARPSRKRGRRPRALKFVDVAVYFSPEEWGCLRPAQRALYRDVMRE
TYGHLGALGCAGPKPALISWLERNTDDWEPAALDPQEYPRGLTVQRKSRTRKKNGEKEVF
PPKEAPRKGKRGRRPSKPRLIPRQTSGGPICPDCGCTFPDHQALESHKCAQNLKKPYPCP
DCGRRFSYPSLLVSHRRAHSGECPYVCDQCGKRFSQRKNLSQHQVIHTGEKPYHCPDCGR
CFRRSRSLANHRTTHTGEKPHQCPSCGRRFAYPSLLAIHQRTHTGEKPYTCLECNRRFRQ
RTALVIHQRIHTGEKPYPCPDCERRFSSSSRLVSHRRVHSGERPYACEHCEARFSQRSTL
LQHQLLHTGEKPYPCPDCGRAFRRSGSLAIHRSTHTEEKLHACDDCGRRFAYPSLLASHR
RVHSGERPYACDLCSKRFAQWSHLAQHQLLHTGEKPFPCLECGRCFRQRWSLAVHKCSPK
APNCSPRSAIGGSSQRGNAH
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcgccaccttcggctccgctccctgcgcagggaccaggaaaggccagacccagtcgg
aaaaggggcaggaggccgagggctctgaagttcgtggacgtggccgtgtacttctccccg
gaggagtggggctgcctgcggcccgcgcagagggccctgtaccgggacgtgatgcgggag
acctacggtcacctgggcgcgctcgggtgcgcaggtcccaaaccagccctcatctcctgg
ttggaacgaaacaccgatgactgggaaccggctgctctagatccgcaggagtacccgaga
gggctaacagtccagagaaaaagcagaaccagaaagaagaatggggagaaggaagtattc
ccgcctaaggaggcaccccgaaaggggaagcgaggccggaggcccagcaaaccccgactg
attcctaggcagacgtccgggggccccatctgccctgactgcggctgtaccttccctgat
catcaggccctggagagccacaagtgcgcccagaatctaaaaaagccttacccttgccca
gactgtgggcgccgcttttcctatccatccctgctggtcagtcaccggcgggcacactcc
ggcgagtgcccctatgtttgtgaccagtgtggcaaacgtttctcccagcgcaagaacctc
tcccagcaccaggtcatccatacaggggagaagccctatcactgccctgactgtggtcgc
tgcttccggaggagccggtccttggccaatcaccggaccacacacacaggtgaaaaaccc
caccagtgccctagctgtggacgtcgcttcgcctacccctccctgctagccatccaccag
cgtacacacacgggagagaagccctacacttgcctcgagtgcaaccgccgcttccgccag
cgcacggccctcgtcatccaccagcgcatccacacgggcgagaagccctacccgtgcccg
gactgcgagcggcgcttctcctcctcctctcgcctggtcagtcaccggcgtgtgcactct
ggggagcgtccctatgcctgcgagcactgtgaggcccgcttctcccagcgcagcacgctg
ctccagcaccagctcttgcacaccggagagaagccctacccctgcccagactgtgggcgt
gccttccggcggagcggctccctggccatccatcgcagcacgcacacagaggagaagctg
cacgcctgcgacgactgtggtcgccgctttgcctacccctcactgctggccagccaccgg
cgcgtgcactcgggcgagcggccctatgcctgcgacctttgctccaagcgttttgctcag
tggagccacctggcccagcaccagctgctgcacacgggggagaagcctttcccctgcctc
gagtgtggccggtgcttccgccagaggtggtctctggctgtccacaagtgtagccccaag
gccccaaactgtagccctagatctgctatcgggggctccagtcagaggggcaacgcccat
tag

DBGET integrated database retrieval system