KEGG   Homo sapiens (human): 115548Help
Entry
115548            CDS       T01001                                 

Gene name
FCHO2
Definition
(RefSeq) FCH and mu domain containing endocytic adaptor 2
  KO
K20042  F-BAR domain only protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    115548 (FCHO2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    115548 (FCHO2)
  Bin/Amphiphysin/Rvs (BAR) family proteins
   F-BAR proteins
    115548 (FCHO2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: muHD FCH Nmad5 PIN_2 DUF1664
Motif
Other DBs
NCBI-GeneID: 115548
NCBI-ProteinID: NP_620137
OMIM: 613438
HGNC: 25180
Ensembl: ENSG00000157107
Vega: OTTHUMG00000162413
Pharos: Q0JRZ9(Tdark)
UniProt: Q0JRZ9
Structure
PDB: 

Position
5q13.2
AA seq 810 aa AA seqDB search
MVMAYFVENFWGEKNSGFDVLYHNMKHGQISTKELADFVRERATIEEAYSRSMTKLAKSA
SNYSQLGTFAPVWDVFKTSTEKLANCHLDLVRKLQELIKEVQKYGEEQVKSHKKTKEEVA
GTLEAVQTIQSITQALQKSKENYNAKCVEQERLKKEGATQREIEKAAVKSKKATDTYKLY
VEKYALAKADFEQKMTETAQKFQDIEETHLIHIKEIIGSLSNAIKEIHLQIGQVHEEFIN
NMANTTVESLIQKFAESKGTGKERPGLIEFEECDTASAVEGIKPRKRKTFALPGIIKKEK
DAESVECPDADSLNIPDVDEEGYSIKPETNQNDTKENHFYSSSDSDSEDEEPKKYRIEIK
PMHPNNSHHTMASLDELKVSIGNITLSPAISRHSPVQMNRNLSNEELTKSKPSAPPNEKG
TSDLLAWDPLFGPSLDSSSSSSLTSSSSARPTTPLSVGTIVPPPRPASRPKLTSGKLSGI
NEIPRPFSPPVTSNTSPPPAAPLARAESSSSISSSASLSAANTPTVGVSRGPSPVSLGNQ
DTLPVAVALTESVNAYFKGADPTKCIVKITGDMTMSFPSGIIKVFTSNPTPAVLCFRVKN
ISRLEQILPNAQLVFSDPSQCDSNTKDFWMNMQAVTVYLKKLSEQNPAASYYNVDVLKYQ
VSSNGIQSTPLNLATYWKCSASTTDLRVDYKYNPEAMVAPSVLSNIQVVVPVDGGVTNMQ
SLPPAIWNAEQMKAFWKLSSISEKSENGGSGSLRAKFDLSEGPSKPTTLAVQFLSEGSTL
SGVDFELVGTGYRLSLIKKRFATGRYLADC
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
atggtcatggcgtatttcgtcgagaatttttggggggaaaaaaatagtggctttgatgtc
ctctaccataatatgaaacatggacagatatcaacaaaagaactagcagattttgtaagg
gaacgagctaccatagaggaggcatactccaggtcaatgacaaaactagcaaaatctgca
agcaattattcacaacttggaacatttgcaccagtatgggatgtattcaaaacatctaca
gagaaattagcaaattgtcacttggatcttgttagaaaattacaagaattaataaaggaa
gttcagaagtatggagaagaacaagtaaagtctcataaaaagactaaagaagaagttgca
ggaactctggaagctgtccaaaccattcagagcataactcaggccctccagaaatccaag
gaaaattacaatgccaagtgtgtagaacaggagcgtttgaaaaaggaaggagctacacaa
agagaaatagaaaaggcagctgttaaatctaagaaagctacagatacctataaactctat
gtggaaaaatatgcattagcaaaagctgatttcgaacagaaaatgacagaaacagctcag
aaatttcaagatattgaagaaactcatctcattcacataaaggaaattataggatccttg
tcaaatgctataaaggaaattcatttgcagataggccaggtccatgaagaatttataaat
aacatggctaatactacagttgaaagtttgatacaaaaatttgctgagtcaaaaggcact
gggaaggaaagacctggcctcattgaatttgaagaatgtgacactgctagtgcagttgaa
ggtataaaaccaaggaaaagaaagacctttgctttgccaggaatcattaaaaaggaaaaa
gatgcagaatctgtggaatgtcctgatgcagattcattgaacattcctgatgtagatgaa
gaaggctacagtattaaaccagaaacaaatcagaatgataccaaagagaaccatttctac
tcatctagtgattctgactccgaagatgaagaaccaaagaagtatcggatagaaattaag
cctatgcatccaaataactcacatcacacaatggcttctttggatgaattaaaagtatct
atagggaatataacactctccccagcaatatctagacacagtccagtacagatgaatcgg
aatttgtctaatgaggagttaacaaaatcaaagccatctgctccacccaatgaaaaagga
accagtgatttacttgcttgggaccccctatttggaccatctcttgattcatcttcttca
tcttcactaacttcatcatcatcagccaggcccacaactcctctttctgtaggcaccatt
gtcccacctccgaggcctgcttccagaccaaagcttacttcaggcaaactcagtgggatt
aatgaaatacccaggccattcagcccacctgtaacttccaacaccagcccacctcctgct
gcaccattagcccgggcagaaagttcttcttctatctcatcatctgcttcattgagtgct
gccaatactccaacagtaggtgtgtcacggggtcccagccctgtcagccttggaaatcag
gataccttacctgtggcagttgcccttacagaatctgttaatgcctactttaaaggagca
gatcccaccaagtgtattgtgaagatcactggtgatatgacaatgtcatttccaagtgga
attattaaagtcttcaccagcaatccaactccagctgtgttgtgcttcagggtgaaaaat
atcagcagactagagcagattcttccaaatgcacagcttgtgttcagtgatccatcacaa
tgtgattccaacacaaaagatttttggatgaacatgcaagctgttacagtctacctcaag
aagctgtcagagcaaaatccagctgcttcttattataatgtagatgtattaaagtatcag
gtatcatcaaatggtattcagtccactcctctgaatcttgcaacatactggaaatgtagt
gctagcaccacagatcttagagtggattataaatacaatccagaagctatggtggcacct
agtgtgctttccaacatacaggtggtggtaccagtggatggaggagtaacgaacatgcag
tcccttccccctgcaatatggaatgcagaacaaatgaaagccttttggaaattgtctagt
atttcagaaaaatcagaaaatggaggttctgggtccctccgagcaaaatttgatctttca
gaaggacctagtaaacccacgacacttgcagtacaattcctcagcgagggaagtaccctt
tcaggagtagatttcgaacttgtgggcactggctataggctttccttaataaagaagcgg
tttgctactggacgatacctggcggattgttga

DBGET integrated database retrieval system