KEGG   Homo sapiens (human): 115557Help
Entry
115557            CDS       T01001                                 

Gene name
ARHGEF25, GEFT, p63RhoGEF
Definition
(RefSeq) Rho guanine nucleotide exchange factor 25
  KO
K20690  Rho guanine nucleotide exchange factor 25
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    115557 (ARHGEF25)
Membrane trafficking [BR:hsa04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    115557 (ARHGEF25)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGEF PH_10 PH SH3-RhoG_link
Motif
Other DBs
NCBI-GeneID: 115557
NCBI-ProteinID: NP_891992
OMIM: 610215
HGNC: 30275
Ensembl: ENSG00000240771
Vega: OTTHUMG00000152516
Pharos: Q86VW2(Tbio)
UniProt: Q86VW2
Structure
PDB: 

Position
12q13.3
AA seq 580 aa AA seqDB search
MRGGHKGGRCACPRVIRKVLAKCGCCFARGGRESYSIAGSEGSISASAASGLAAPSGPSS
GLSSGPCSPGPPGPVSGLRRWLDHSKHCLSVETEADSGQAGPYENWMLEPALATGEELPE
LTLLTTLLEGPGDKTQPPEEETLSQAPESEEEQKKKALERSMYVLSELVETEKMYVDDLG
QIVEGYMATMAAQGVPESLRGRDRIVFGNIQQIYEWHRDYFLQELQRCLKDPDWLAQLFI
KHERRLHMYVVYCQNKPKSEHVVSEFGDSYFEELRQQLGHRLQLNDLLIKPVQRIMKYQL
LLKDFLKYYNRAGMDTADLEQAVEVMCFVPKRCNDMMTLGRLRGFEGKLTAQGKLLGQDT
FWVTEPEAGGLLSSRGRERRVFLFEQIIIFSEALGGGVRGGTQPGYVYKNSIKVSCLGLE
GNLQGDPCRFALTSRGPEGGIQRYVLQAADPAISQAWIKHVAQILESQRDFLNALQSPIE
YQRRESQTNSLGRPRGPGVGSPGRIQLGDQAQGSTHTPINGSLPSLLLSPKGEVARALLP
LDKQALGDIPQAPHDSPPVSPTPKTPPCQARLAKLDEDEL
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgcggggggggcacaaagggggtcgctgtgcctgtccccgtgtgatccgaaaagtgctg
gcaaaatgcggctgctgcttcgcccgggggggacgtgaatcctattccattgcgggcagt
gaggggagtatatcggcttctgctgcctccggtctggctgccccctctggccccagctct
ggcctcagctctggcccctgttccccaggccccccagggcccgtcagtggcctgaggaga
tggttggatcattccaaacattgtctcagtgtggaaactgaggcagacagtggtcaggca
ggaccatatgagaactggatgttggagccagctctagccacaggagaggagctgccggaa
ctgaccttgctgaccacactgttggagggccctggagataagacgcagccacctgaagag
gagactttgtcccaagcccctgagagtgaggaggaacagaagaagaaggctctggaaagg
agtatgtatgtcctgagtgaactggtagaaacagagaaaatgtacgtggacgacttgggg
cagattgtggagggttatatggccaccatggctgctcagggggtccccgagagtcttcga
ggccgtgacaggattgtgtttgggaatatccagcaaatctatgagtggcaccgagactat
ttcttgcaagagctacaacggtgtctgaaagatcctgattggctggctcagctattcatc
aaacacgagcgccggctgcatatgtatgtggtgtactgtcagaataagcccaagtcagag
catgtggtgtcagagtttggggacagctactttgaggagctccggcagcagctggggcac
cgcctgcagctgaacgacctcctcatcaaacctgtgcagcggatcatgaaataccagctg
ctgctcaaggattttctcaagtattacaatagagctgggatggatactgcagacctagag
caagctgtggaggtcatgtgctttgtgcccaagcgctgcaacgatatgatgacgctgggg
agattgcggggatttgagggcaaactgactgctcaggggaagctcttgggccaggacact
ttctgggtcaccgagcctgaggctggagggctgctgtcttcccgaggtcgagagaggcgc
gtcttcctctttgagcaaatcatcatcttcagtgaagccctgggaggaggagtgagaggt
ggaacacagcctggatatgtatacaagaacagcattaaggtgagctgcctgggactggag
gggaacctccaaggtgacccttgccgctttgcactgacctccagagggccagagggtggg
atccagcgctatgtcctgcaggctgcagaccctgctatcagtcaggcctggatcaagcat
gtggctcagatcttggagagccaacgggacttcctcaacgcattgcagtcacccattgag
taccagagacgggagagccagaccaacagcctggggcggccaagagggcctggagtgggg
agccctggaagaattcagcttggagatcaggcccagggcagcacacacacacccatcaat
ggctctctcccctctctgctgctgtcacccaaaggggaggtggccagagccctcttgcca
ctggataaacaggcccttggtgacatcccccaggctccccatgactctcctccagtctct
ccaactccaaaaacccctccctgccaagccagacttgccaagctggatgaagatgagctg
taa

DBGET integrated database retrieval system