KEGG   Homo sapiens (human): 115584Help
Entry
115584            CDS       T01001                                 

Gene name
SLC5A11, KST1, RKST1, SGLT6, SMIT2
Definition
(RefSeq) solute carrier family 5 member 11
  KO
K14391  solute carrier family 5 (sodium/myo-inositol cotransporter), member 11
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    115584 (SLC5A11)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC5: Sodium glucose cotransporter
   115584 (SLC5A11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SSF
Motif
Other DBs
NCBI-GeneID: 115584
NCBI-ProteinID: NP_443176
OMIM: 610238
HGNC: 23091
Ensembl: ENSG00000158865
Vega: OTTHUMG00000097003
Pharos: Q8WWX8(Tchem)
UniProt: Q8WWX8
Position
16p12.1
AA seq 675 aa AA seqDB search
MESGTSSPQPPQLDPLDAFPQKGLEPGDIAVLVLYFLFVLAVGLWSTVKTKRDTVKGYFL
AGGDMVWWPVGASLFASNVGSGHFIGLAGSGAATGISVSAYELNGLFSVLMLAWIFLPIY
IAGQVTTMPEYLRKRFGGIRIPIILAVLYLFIYIFTKISVDMYAGAIFIQQSLHLDLYLA
IVGLLAITAVYTVAGGLAAVIYTDALQTLIMLIGALTLMGYSFAAVGGMEGLKEKYFLAL
ASNRSENSSCGLPREDAFHIFRDPLTSDLPWPGVLFGMSIPSLWYWCTDQVIVQRTLAAK
NLSHAKGGALMAAYLKVLPLFIMVFPGMVSRILFPDQVACADPEICQKICSNPSGCSDIA
YPKLVLELLPTGLRGLMMAVMVAALMSSLTSIFNSASTIFTMDLWNHLRPRASEKELMIV
GRVFVLLLVLVSILWIPVVQASQGGQLFIYIQSISSYLQPPVAVVFIMGCFWKRTNEKGA
FWGLISGLLLGLVRLVLDFIYVQPRCDQPDERPVLVKSIHYLYFSMILSTVTLITVSTVS
WFTEPPSKEMVSHLTWFTRHDPVVQKEQAPPAAPLSLTLSQNGMPEASSSSSVQFEMVQE
NTSKTHSCDMTPKQSKVVKAILWLCGIQEKGKEELPARAEAIIVSLEENPLVKTLLDVNL
IFCVSCAIFIWGYFA
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atggagagcggcaccagcagccctcagcctccacagttagatcccctggatgcgtttccc
cagaagggcttggagcctggggacatcgcggtgctagttctgtacttcctctttgtcctg
gctgttggactatggtccacagtgaagaccaaaagagacacagtgaaaggctacttcctg
gctggaggggacatggtgtggtggccagtgggtgcatccttgtttgccagcaatgttgga
agtggacatttcattggcctggcagggtcaggtgctgctacgggcatttctgtatcagct
tatgaacttaatggcttgttttctgtgctgatgttggcctggatcttcctacccatctac
attgctggtcaggtcaccacgatgccagaatacctacggaagcgcttcggtggcatcaga
atccccatcatcctggctgtactctacctatttatctacatcttcaccaagatctcggta
gacatgtatgcaggtgccatcttcatccagcagtctttgcacctggatctgtacctggcc
atagttgggctactggccatcactgctgtatacacggttgctggtggcctggctgctgtg
atctacacggatgccctgcagacgctgatcatgcttataggagcgctcaccttgatgggc
tacagtttcgccgcggttggtgggatggaaggactgaaggagaagtacttcttggccctg
gctagcaaccggagtgagaacagcagctgcgggctgccccgggaagatgccttccatatt
ttccgagatccgctgacatctgatctcccgtggccgggggtcctatttggaatgtccatc
ccatccctctggtactggtgcacggatcaggtgattgtccagcggactctggctgccaag
aacctgtcccatgccaaaggaggtgctctgatggctgcatacctgaaggtgctgcccctc
ttcataatggtgttccctgggatggtcagccgcatcctcttcccagatcaagtggcctgt
gcagatccagagatctgccagaagatctgcagcaacccctcaggctgttcggacatcgcg
tatcccaaactcgtgctggaactcctgcccacagggctccgtgggctgatgatggctgtg
atggtggcggctctcatgtcctccctcacctccatctttaacagtgccagcaccatcttc
accatggacctctggaatcacctccggcctcgggcatctgagaaggagctcatgattgtg
ggcagggtgtttgtgctgctgctggtcctggtctccatcctctggatccctgtggtccag
gccagccagggcggccagctcttcatctatatccagtccatcagctcctacctgcagccg
cctgtggcggtggtcttcatcatgggatgtttctggaagaggaccaatgaaaagggtgcc
ttctggggcctgatctcgggcctgctcctgggcttggttaggctggtcctggactttatt
tacgtgcagcctcgatgcgaccagccagatgagcgcccggtcctggtgaagagcattcac
tacctctacttctccatgatcctgtccacggtcaccctcatcactgtctccaccgtgagc
tggttcacagagccaccctccaaggagatggtcagccacctgacctggtttactcgtcac
gaccccgtggtccagaaggaacaagcaccaccagcagctcccttgtctcttaccctctct
cagaacgggatgccagaggccagcagcagcagcagcgtccagttcgagatggttcaagaa
aacacgtctaaaacccacagctgtgacatgaccccaaagcagtccaaagtggtgaaggcc
atcctgtggctctgtggaatacaggagaagggcaaggaagagctcccggccagagcagaa
gccatcatagtttccctggaagaaaaccccttggtgaagaccctcctggacgtcaacctc
attttctgcgtgagctgcgccatctttatctggggctattttgcttag

DBGET integrated database retrieval system