KEGG   Homo sapiens (human): 115650Help
Entry
115650            CDS       T01001                                 

Gene name
TNFRSF13C, BAFF-R, BAFFR, BROMIX, CD268, CVID4, prolixin
Definition
(RefSeq) TNF receptor superfamily member 13C
  KO
K05151  tumor necrosis factor receptor superfamily member 13C
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04064  NF-kappa B signaling pathway
hsa04672  Intestinal immune network for IgA production
hsa05166  Human T-cell leukemia virus 1 infection
hsa05340  Primary immunodeficiency
Disease
H00088  Common variable immunodeficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    115650 (TNFRSF13C)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    115650 (TNFRSF13C)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    115650 (TNFRSF13C)
 09160 Human Diseases
  09163 Immune diseases
   05340 Primary immunodeficiency
    115650 (TNFRSF13C)
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    115650 (TNFRSF13C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    115650 (TNFRSF13C)
   04090 CD molecules [BR:hsa04090]
    115650 (TNFRSF13C)
Cytokine receptors [BR:hsa04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   115650 (TNFRSF13C)
CD molecules [BR:hsa04090]
 Proteins
  115650 (TNFRSF13C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BaffR-Tall_bind BatA DUF4079 SKG6 DUF4381 stn_TNFRSF12A SIT
Motif
Other DBs
NCBI-GeneID: 115650
NCBI-ProteinID: NP_443177
OMIM: 606269
HGNC: 17755
Ensembl: ENSG00000159958
Vega: OTTHUMG00000151271
Pharos: Q96RJ3(Tbio)
UniProt: Q96RJ3 Q5H8V1
Structure
PDB: 

Position
22q13.2
AA seq 184 aa AA seqDB search
MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQ
ESVGAGAGEAALPLPGLLFGAPALLGLALVLALVLVGLVSWRRRQRRLRGASSAEAPDGD
KDAPEPLDKVIILSPGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAG
PEQQ
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgagggccccggagcctgcggggcagggacgcgccagcccccacgccctgcgtc
ccggccgagtgcttcgacctgctggtccgccactgcgtggcctgcgggctcctgcgcacg
ccgcggccgaaaccggccggggccagcagccctgcgcccaggacggcgctgcagccgcag
gagtcggtgggcgcgggggccggcgaggcggcgctgcccctgcccgggctgctctttggc
gcccccgcgctgctgggcctggcactggtcctggcgctggtcctggtgggtctggtgagc
tggaggcggcgacagcggcggcttcgcggcgcgtcctccgcagaggcccccgacggagac
aaggacgccccagagcccctggacaaggtcatcattctgtctccgggaatctctgatgcc
acagctcctgcctggcctcctcctggggaagacccaggaaccaccccacctggccacagt
gtccctgtgccagccacagagctgggctccactgaactggtgaccaccaagacggccggc
cctgagcaacaatag

DBGET integrated database retrieval system