KEGG   Homo sapiens (human): 115703
Entry
115703            CDS       T01001                                 

Gene name
ARHGAP33, NOMA-GAP, SNX26, TCGAP
Definition
(RefSeq) Rho GTPase activating protein 33
  KO
K17933  Rho GTPase-activating protein 33
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    115703 (ARHGAP33)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    115703 (ARHGAP33)
Membrane trafficking [BR:hsa04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    115703 (ARHGAP33)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Phox homology (PX) domain-containing proteins
  Sorting nexins
   115703 (ARHGAP33)
SSDB
Motif
Pfam: RhoGAP SH3_9 SH3_2 SH3_1 PX
Other DBs
NCBI-GeneID: 115703
NCBI-ProteinID: NP_443180
OMIM: 614902
HGNC: 23085
Ensembl: ENSG00000004777
Vega: OTTHUMG00000182071
Pharos: O14559(Tbio)
UniProt: O14559 A1A5D2
Position
19q13.12
AA seq 1126 aa
MVARSTDSLDGPGEGSVQPLPTAGGPSVKGKPGKRLSAPRGPFPRLADCAHFHYENVDFG
HIQLLLSPDREGPSLSGENELVFGVQVTCQGRSWPVLRSYDDFRSLDAHLHRCIFDRRFS
CLPELPPPPEGARAAQMLVPLLLQYLETLSGLVDSNLNCGPVLTWMELDNHGRRLLLSEE
ASLNIPAVAAAHVIKRYTAQAPDELSFEVGDIVSVIDMPPTEDRSWWRGKRGFQVGFFPS
ECVELFTERPGPGLKADADGPPCGIPAPQGISSLTSAVPRPRGKLAGLLRTFMRSRPSRQ
RLRQRGILRQRVFGCDLGEHLSNSGQDVPQVLRCCSEFIEAHGVVDGIYRLSGVSSNIQR
LRHEFDSERIPELSGPAFLQDIHSVSSLCKLYFRELPNPLLTYQLYGKFSEAMSVPGEEE
RLVRVHDVIQQLPPPHYRTLEYLLRHLARMARHSANTSMHARNLAIVWAPNLLRSMELES
VGMGGAAAFREVRVQSVVVEFLLTHVDVLFSDTFTSAGLDPAGRCLLPRPKSLAGSCPST
RLLTLEEAQARTQGRLGTPTEPTTPKAPASPAERRKGERGEKQRKPGGSSWKTFFALGRG
PSVPRKKPLPWLGGTRAPPQPSGSRPDTVTLRSAKSEESLSSQASGAELLGAGGAPASAT
PTPALSPGRSLRPHLIPLLLRGAEAPLTDACQQEMCSKLRGAQGPLGPDMESPLPPPPLS
LLRPGGAPPPPPKNPARLMALALAERAQQVAEQQSQQECGGTPPASQSPFHRSLSLEVGG
EPLGTSGSGPPPNSLAHPGAWVPGPPPYLPRQQSDGSLLRSQRPMGTSRRGLRGPAQVSA
QLRAGGGGRDAPEAAAQSPCSVPSQVPTPGFFSPAPRECLPPFLGVPKPGLYPLGPPSFQ
PSSPAPVWRSSLGPPAPLDRGENLYYEIGASEGSPYSGPTRSWSPFRSMPPDRLNASYGM
LGQSPPLHRSPDFLLSYPPAPSCFPPDHLGYSAPQHPARRPTPPEPLYVNLALGPRGPSP
ASSSSSSPPAHPRSRSDPGPPVPRLPQKQRAPWGPRTPHRVPGPWGPPEPLLLYRAAPPA
YGRGGELHRGSLYRNGGQRGEGAGPPPPYPTPSWSLHSEGQTRSYC
NT seq 3381 nt   +upstreamnt  +downstreamnt
atggtggcacgcagcactgacagcctggatggcccaggggagggctcggtgcagcctcta
cccactgctggggggcccagtgtgaaggggaagcctgggaagaggctctcagctcctcga
ggccccttcccgcggctggctgactgcgcccatttccactacgagaacgttgactttggc
cacattcagctcctgctgtctccagaccgtgaagggcccagcctctctggagagaatgag
ctggtgttcggggtgcaggtgacctgtcagggccgttcctggccggttctccggagttac
gatgactttcgttccctggatgcccacctccaccggtgcatatttgaccggaggttctcc
tgccttccggagcttcccccgccccccgagggtgccagggctgcccagatgctggtgcca
ctgctgctgcagtacctggagacactgtcaggactggtggacagtaacctcaactgcggg
cctgtgctcacctggatggagctggacaatcacggccggcgactgctcctcagtgaggag
gcgtcactcaatatccctgcagtggcggccgcccatgtgatcaaacggtatacagcccag
gcgccagatgagctgtcctttgaggtgggagacattgtctcggtgatcgacatgccaccc
acagaggatcggagctggtggcggggcaagcgaggcttccaggtcgggttcttccccagt
gagtgtgtggaactcttcacagagcggccaggtccgggcctgaaggcggatgccgatggc
cccccatgtggcatcccggctccccagggtatctcgtctctgacctcagctgtgccacgg
cctcgtgggaagctggccggcctgctccgcaccttcatgcgctcccgcccttctcggcag
cggctgcggcagcggggaatcctgcgacagagggtgtttggctgcgatcttggcgagcac
ctcagcaactcaggccaggatgtgccccaggtgctgcgctgctgctccgagttcattgag
gcccacggggtggtggatgggatctaccggctctcaggcgtgtcttccaacatccagagg
cttcggcacgagtttgacagtgagaggatcccggagctgtctggccctgcattcctgcag
gacatccacagcgtgtcctccctctgcaagctctacttccgagagcttccgaaccctctg
ctcacctaccagctctatgggaagttcagtgaggccatgtcagtgcctggggaggaggag
cgtctggtgcgggtgcacgatgtcatccagcagctgcccccaccacattacaggaccctg
gagtacctgctgaggcacctggcccgcatggcgagacacagtgccaacaccagcatgcat
gcccgcaacctggccattgtctgggcacccaacctgctacggtccatggagctggagtca
gtgggaatgggtggcgcggcggcgttccgggaagttcgggtgcagtcggtggtggtggag
tttctgctcacccatgtggacgtcctgttcagcgacaccttcacctccgccggcctcgac
cctgcaggccgctgcctgctccccaggcccaagtcccttgcgggcagctgcccctccacc
cgcctgctgacgctggaggaagcccaggcacgcacccagggccggctggggacgcccacg
gagcccacaactcccaaggccccggcctcacctgcggaaaggaggaaaggggagagaggg
gagaagcagcggaagccagggggcagcagctggaagacgttctttgcactgggccggggc
cccagtgtccctcgaaagaagcccctgccctggctggggggcacccgtgccccaccgcag
ccttcaggcagcagacccgacaccgtcacactgagatctgccaagagcgaggagtctctg
tcatcgcaggccagcggggctgaactgctgggggctgggggagcacctgcctcagccacc
ccaacaccagctctcagccccggccggagcctgcgcccccatctcatacccctgctgctg
cgaggagccgaggccccgctgactgacgcctgccagcaggagatgtgcagcaagctccgg
ggagcccagggcccactcggtcctgatatggagtcaccactgccaccccctcccctgtct
ctcctgcgccctgggggtgccccacccccgccccctaagaacccagcacgcctcatggcc
ctggccctggctgagcgggctcagcaggtggccgagcaacagagccagcaggagtgtggg
ggcaccccacctgcttcccaatcccccttccaccgctcgctgtctctggaggtgggcggg
gagcccctggggacctcagggagtgggccacctcccaactccctagcacacccgggtgcc
tgggtcccgggacccccaccctacttaccaaggcaacaaagtgatgggagcctgctgagg
agccagcggcccatggggacctcaaggaggggactccgaggccctgcccaggtcagtgcc
cagctcagggcaggtggcgggggcagggatgcgccagaggcagcagcccagtccccatgt
tctgtcccctcacaggttcctacccccggcttcttctccccagcccccagggagtgcctg
ccacccttcctcggggtccccaagccaggcttgtaccccctgggccccccatccttccag
cccagttccccagccccagtctggaggagctctctgggcccccctgcaccactcgacagg
ggagagaacctgtactatgagatcggggcaagtgaggggtccccctattctggccccacc
cgctcctggagtccctttcgctccatgccccccgacaggctcaatgcctcctacggcatg
cttggccaatcacccccactccacaggtcccccgacttcctgctcagctacccgccagcc
ccctcctgctttccccctgaccaccttggctactcagccccccagcaccctgctcggcgc
cctacaccgcctgagcccctctacgtcaacctagctctagggcccaggggtccctcacct
gcctcttcctcctcctcttcccctcctgcccacccccgaagccgttcagatcccggtccc
ccagtcccccgccttccccagaaacaacgggcaccctggggaccccgtacccctcatagg
gtgccgggtccctggggccctcctgagcctctcctgctctacagggcagccccgccagcc
tacggaagggggggcgagctccaccgagggtccttgtacagaaatggagggcaaagaggg
gagggggctggtcccccacccccttaccccactcccagctggtccctccactctgagggc
cagacccgaagctactgctga

DBGET integrated database retrieval system