KEGG   Homo sapiens (human): 115749
Entry
115749            CDS       T01001                                 
Symbol
C12orf56
Name
(RefSeq) chromosome 12 open reading frame 56
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: DUF4551 DUF5535
Other DBs
NCBI-GeneID: 115749
NCBI-ProteinID: NP_001164104
HGNC: 26967
Ensembl: ENSG00000185306
Pharos: Q8IXR9(Tdark)
UniProt: Q8IXR9
Position
12:complement(64264762..64390758)
AA seq 622 aa
MASPLPSGFPARRNSRLDVFLRRHLPPEVYDAVRAYEPCIVVSNSENHILKYVVLSDRLV
YLTENPPKSIRRVVALRDVVAIDLIDDYPEFLSSPDREISQHIRIIYSSTVLKKECKKSN
SVRKFLFPFHHTKANNKKVKEEKNGLAFWRSKESRSLKESPLRDQQESSTPSKDSTLCPR
PGLKKLSLHGQGAFRPLPSPSRRSSQSAPTTGKAVSEPSCTTNTKEPQGLPDHNSISEIP
FKCNGNGNEFYLGNSLLDSPSQSNSNLEKKESELHLYVISTTSSIFLHLKSSWNNYIIKA
TLLQDPFYASEFSPAIGSQKPYRSEEKIKHFSQLKSELFLKDNSLRRILSLLMELKVAAQ
KNFILKRLFWKTSDLFYFIVNKLHEYLPESRDKNALQNQSQRVDELVACIEIIQTLVLMF
RETETESSRLNTLAAKKGALFNLLVILISEPQIPKSCPVFDIQLVADSALVRMSFDAELQ
KLILEYTNTATALLYEILLVFQQGNLGLGSTKFAISWIMSFLQSCPPIITFVASIVKQVV
RGLSASFQLLSPCQAVLLYQQFYILKSCLRHSRTLAEYIRNNYREEFRYFIHMPALQKRL
PLCYPITQPTIQLFHEVLKLVE
NT seq 1869 nt   +upstreamnt  +downstreamnt
atggccagccccttgccgtccggcttccccgcgcgcaggaacagccgcctggatgtgttc
ctgcggcggcatctgccgcccgaggtctacgacgcggtccgcgcctacgagccatgcatc
gtggtgtccaactctgagaaccacatcctcaagtatgtggtgctaagcgaccggctcgtc
tacctaaccgagaacccgcccaagtccatccggcgggtagtggctctgcgggacgtcgtg
gccattgacctgattgatgattacccggaatttttgagttcgccagatagagaaatcagc
caacacattcgtatcatctattcttcaaccgttttgaaaaaagagtgtaaaaagtcaaac
agtgtcaggaaattcctatttccatttcatcatactaaagctaacaacaagaaagtcaag
gaagaaaagaacggccttgccttttggagaagcaaagagtccagaagtctgaaagaatct
cctctcagggaccagcaggagagcagtacaccatccaaggactcaactctctgtcctcgt
ccaggcctcaaaaagctgtcccttcatggccaaggtgcctttcgacccctaccttccccc
tccaggaggagctctcagtctgcaccaacaactggcaaggctgtcagcgagccatcttgc
acaacaaacacaaaagaaccccagggacttccagatcacaactccataagtgaaattcct
ttcaagtgcaatgggaatggaaatgagttttacttaggaaattccctcttagattcccct
tcacagagcaactcaaatttagagaaaaaggagtcagaacttcatttgtatgttatttcc
acaacctcatcaatatttctgcacttaaaaagttcatggaacaattatattataaaagct
actcttttacaagatcccttctatgctagtgagttcagtcctgctattggaagtcaaaag
ccatataggtctgaggagaaaattaagcacttcagtcaacttaaatctgaactttttctt
aaagacaattctttgaggaggatactttctttacttatggaacttaaagtagcagcccag
aaaaacttcattctgaaaaggcttttctggaagaccagtgaccttttctatttcatagta
aacaaacttcatgagtacttgccggagtctagggataagaatgcactacaaaatcaaagc
caaagggttgatgagctggtggcatgcattgaaattatacagaccctagtattgatgttc
agagaaacagaaaccgagtcatcacgcctgaacacattggcagctaagaagggagcacta
tttaatctcttggtaattttaattagtgagcctcagattccaaaatcttgtcctgtgttt
gatatccagttggtggctgattcagctttagtcagaatgtcttttgacgctgagttacag
aagcttattctggagtatacaaatactgctacagcacttttatatgagatacttctggtc
tttcagcagggaaatctcggattgggatccacaaagtttgctattagctggataatgtcc
tttctacaaagctgtcctcccatcattacttttgtggccagtattgtgaaacaagtggtg
aggggtctttcagcttcatttcagctgctaagtccctgccaagcagttctgttgtaccag
caattttacatcctcaagagctgtctgcggcacagcaggactctagctgagtatattagg
aataactacagagaagaattcaggtactttattcacatgccagccttgcagaaaaggctc
ccattgtgttaccccatcactcaacctaccattcaactttttcatgaagttctgaaattg
gttgaatag

DBGET integrated database retrieval system