KEGG   Homo sapiens (human): 115752
Entry
115752            CDS       T01001                                 

Symbol
DIS3L, DIS3L1
Name
(RefSeq) DIS3 like exosome 3'-5' exoribonuclease
  KO
K18681  DIS3-like exonuclease 1 [EC:3.1.13.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    115752 (DIS3L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    115752 (DIS3L)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.-  
     115752 (DIS3L)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Exosome cofactors
     115752 (DIS3L)
SSDB
Motif
Pfam: RNB OB_Dis3 CSD2 Rrp44_S1 Rrp44_CSD1
Other DBs
NCBI-GeneID: 115752
NCBI-ProteinID: NP_001137160
OMIM: 614183
HGNC: 28698
Ensembl: ENSG00000166938
Vega: OTTHUMG00000133181
Pharos: Q8TF46(Tdark)
UniProt: Q8TF46
Position
15q22.31
AA seq 1054 aa
MLQKREKVLLLRTFQGRTLRIVREHYLRPCVPCHSPLCPQPAACSHDGKLLSSDVTHYVI
PDWKVVQDYLEILEFPELKGIIFMQTACQAVQHQRGRRQYNKLRNLLKDARHDCILFANE
FQQCCYLPRERGESMEKWQTRSIYNAAVWYYHHCQDRMPIVMVTEDEEAIQQYGSETEGV
FVITFKNYLDNFWPDLKAAHELCDSILQSRRERENESQESHGKEYPEHLPLEVLEAGIKS
GRYIQGILNVNKHRAQIEAFVRLQGASSKDSDLVSDILIHGMKARNRSIHGDVVVVELLP
KNEWKGRTVALCENDCDDKASGESPSEPMPTGRVVGILQKNWRDYVVTFPSKEEVQSQGK
NAQKILVTPWDYRIPKIRISTQQAETLQDFRVVVRIDSWESTSVYPNGHFVRVLGRIGDL
EGEIATILVENSISVIPFSEAQMCEMPVNTPESPWKVSPEEEQKRKDLRKSHLVFSIDPK
GCEDVDDTLSVRTLNNGNLELGVHIADVTHFVAPNSYIDIEARTRATTYYLADRRYDMLP
SVLSADLCSLLGGVDRYAVSIMWELDKASYEIKKVWYGRTIIRSAYKLFYEAAQELLDGN
LSVVDDIPEFKDLDEKSRQAKLEELVWAIGKLTDIARHVRAKRDGCGALELEGVEVCVQL
DDKKNIHDLIPKQPLEVHETVAECMILANHWVAKKIWESFPHQALLRQHPPPHQEFFSEL
RECAKAKGFFIDTRSNKTLADSLDNANDPHDPIVNRLLRSMATQAMSNALYFSTGSCAEE
EFHHYGLALDKYTHFTSPIRRYSDIVVHRLLMAAISKDKKMEIKGNLFSNKDLEELCRHI
NNRNQAAQHSQKQSTELFQCMYFKDKDPATEERCISDGVIYSIRTNGVLLFIPRFGIKGA
AYLKNKDGLVISCGPDSCSEWKPGSLQRFQNKITSTTTDGESVTFHLFDHVTVRISIQAS
RCHSDTIRLEIISNKPYKIPNTELIHQSSPLLKSELVKEVTKSVEEAQLAQEVKVNIIQE
EYQEYRQTKGRSLYTLLEEIRDLALLDVSNNYGI
NT seq 3165 nt   +upstreamnt  +downstreamnt
atgctgcagaagcgggagaaggtgctgctgctgaggaccttccagggccgcacgctgcgg
atcgtgcgcgagcactacctgcggccctgcgtgccctgccacagcccgctctgcccgcag
cccgccgcctgcagccacgatgggaaactcttgtctagtgatgtgactcattacgtgatc
ccagactggaaagttgttcaagattatcttgagatccttgagtttcctgagttgaaggga
attattttcatgcagacagcttgtcaagctgtgcagcatcaaagaggcaggagacagtat
aacaaactgcgaaacctgctgaaggatgcgcgtcatgattgcattctctttgctaatgaa
ttccagcaatgctgctatctgccacgggaaagaggagagtccatggagaagtggcagacc
aggagcatatacaacgcagctgtttggtactatcatcactgccaggacaggatgccaatt
gttatggtgacagaagatgaagaggcaattcagcagtatggaagtgaaacagaaggagta
ttcgtgattactttcaagaattacctggacaatttctggcctgatttaaaagctgcccac
gagctttgtgattctatccttcagtctcgacgggagagagagaatgagagtcaggagagc
catgggaaggagtacccagaacatcttcccctggaagtgttagaagctgggattaaatct
ggacgctatatccagggaattctgaatgtcaacaaacacagagcccaaatagaagctttt
gttcgacttcaaggagccagcagtaaagattcagatttagtcagtgacatcctaatccac
gggatgaaggctcgaaaccgctcaattcatggagatgtggtagttgtggagctgcttcct
aaaaatgaatggaaaggaagaaccgtagccctgtgtgagaatgactgtgacgacaaggct
tcgggcgagtccccaagtgagcccatgcctacaggtcgagtggtgggcatacttcagaag
aactggcgggattatgtggtgacatttccgtccaaagaagaggtccaatctcagggcaaa
aatgctcagaaaatcctggttacaccttgggattacagaattcccaaaattcgaattagc
actcagcaagcagaaaccctccaggacttcagggtggtcgtgcgcatcgattcctgggag
tcaacatctgtgtatccaaatggacattttgtgcgtgttttaggaagaatcggagatctg
gaaggggaaattgcaaccatcctggtggaaaacagtatttcagttattcctttctcagaa
gctcagatgtgtgagatgccagtaaacacaccagaaagtccctggaaggtgagtcctgaa
gaggaacaaaaacgtaaagacttgaggaaaagccatctcgtattcagcattgaccccaaa
ggttgtgaagatgtggatgacacactctcagtcagaaccttaaataatggcaacctggaa
cttggggtccacatcgcagatgtaacacactttgtggcaccaaattcttacattgatatt
gaagctagaacaagggccaccacttattatctagcagatcgtcgctatgacatgctgcct
tccgtcctcagtgcagatttgtgttcccttctgggaggcgttgataggtatgctgtaagc
atcatgtgggaactggataaagcctcttatgaaattaagaaagtgtggtatggcagaacc
attattcgatcagcatacaaactgttctatgaagcagcccaagaactactggatggaaac
ttaagcgttgttgatgatattccagaattcaaagacttggatgagaagagcagacaagcc
aagctggaggagttggtgtgggcaattggaaagctgaccgacatagctcgccatgtcaga
gctaaacgagacggatgtggtgccctggaactggaaggggtagaggtttgcgtacagcta
gatgacaaaaagaacattcacgacctcatccccaagcagcccctggaagtccacgagaca
gtggctgaatgcatgatcctggccaaccactgggtcgccaaaaagatctgggagagcttc
cctcatcaggccttgctgcgccagcaccctcctccacaccaggagttcttttcagaactc
cgggaatgtgctaaagccaaaggcttcttcatagatacacggtccaataaaacactggct
gattctctggataatgcgaacgacccccacgatcccattgtgaacaggctactgcgctcc
atggccacgcaggccatgtcgaatgctctgtacttctccaccggatcctgtgcggaggag
gagttccatcattacggtcttgcattagataaatatacccactttacttctccaataaga
agatattcagatattgtagtacaccgcttgttaatggcagccatttcaaaagataagaaa
atggaaattaagggaaatctgttcagcaacaaagatcttgaggaattatgcagacatatc
aacaacagaaaccaagcagcacagcattctcagaagcagtctactgagctcttccagtgc
atgtacttcaaagacaaagaccctgccaccgaggagcgttgcatatctgacggagttatt
tattcaattagaacaaatggtgtgcttctatttataccaaggtttgggattaaaggtgct
gcttatctaaaaaataaagatggtttagtcatctcatgtggcccagatagctgttctgaa
tggaaaccaggatcccttcaacgatttcaaaacaaaattacctctactacaacagatggg
gaatctgttacgttccatttgtttgaccatgtaaccgtaagaatatccatacaggcctca
cgttgccattctgatacaatcagacttgaaataattagtaacaaaccatacaagatacca
aatacagaacttattcatcagagttcccccttgctgaagagtgagttagtgaaagaagta
actaaatctgtggaagaagctcagcttgcccaagaagtcaaagtaaacatcattcaggag
gaatatcaagaatatcgccaaacaaagggaaggagcctatacacacttctagaggagata
cgggacctagctctcctggatgtttcaaacaattatggaatatga

DBGET integrated database retrieval system