KEGG   Homo sapiens (human): 115761Help
Entry
115761            CDS       T01001                                 

Gene name
ARL11, ARLTS1
Definition
(RefSeq) ADP ribosylation factor like GTPase 11
  KO
K07959  ADP-ribosylation factor-like protein 11
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    115761 (ARL11)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Arf/Sar Family
   Others
    115761 (ARL11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arf SRPRB Roc Ras G-alpha Gtr1_RagA MMR_HSR1 6PF2K PduV-EutP DLIC
Motif
Other DBs
NCBI-GeneID: 115761
NCBI-ProteinID: NP_612459
OMIM: 609351
HGNC: 24046
Ensembl: ENSG00000152213
Vega: OTTHUMG00000016919
Pharos: Q969Q4(Tbio)
UniProt: Q969Q4
Position
13q14.2
AA seq 196 aa AA seqDB search
MGSVNSRGHKAEAQVVMMGLDSAGKTTLLYKLKGHQLVETLPTVGFNVEPLKAPGHVSLT
LWDVGGQAPLRASWKDYLEGTDILVYVLDSTDEARLPESAAELTEVLNDPNMAGVPFLVL
ANKQEAPDALPLLKIRNRLSLERFQDHCWELRGCSALTGEGLPEALQSLWSLLKSRSCMC
LQARAHGAERGDSKRS
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgggttctgtgaattccagaggtcacaaggcggaagcccaggtggtgatgatgggcctg
gactcggcgggcaagaccacgctcctttacaagctgaagggccaccagctggtggagacc
ctgcccactgttggtttcaacgtggagcctctgaaagctcctgggcacgtgtcactgact
ctctgggacgttggggggcaggccccgctcagagccagctggaaggactatctggaaggc
acagatatcctcgtgtacgtgctggacagcacagatgaagcccgcttacccgagtcggcg
gctgagctcacagaagtcctgaacgaccccaacatggctggcgtccccttcttggtgctg
gccaacaagcaggaggcacctgatgcacttccgctgcttaagatcagaaacaggctgagt
ctagagagattccaggaccactgctgggagctccggggctgcagtgccctcactggggag
gggctgcccgaggccctgcagagcctgtggagcctcctgaaatctcgcagctgcatgtgt
ctgcaggcgagagcccatggggctgagcgcggagacagcaagagatcttga

DBGET integrated database retrieval system