KEGG   Homo sapiens (human): 1158
Entry
1158              CDS       T01001                                 
Symbol
CKM, CKMM, CPK-M, M-CK
Name
(RefSeq) creatine kinase, M-type
  KO
K00933  creatine kinase [EC:2.7.3.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00330  Arginine and proline metabolism
hsa01100  Metabolic pathways
Module
hsa_M00047  Creatine pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    1158 (CKM)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1158 (CKM)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.2  creatine kinase
     1158 (CKM)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   1158 (CKM)
SSDB
Motif
Pfam: ATP-gua_Ptrans ATP-gua_PtransN DUF2380
Other DBs
NCBI-GeneID: 1158
NCBI-ProteinID: NP_001815
OMIM: 123310
HGNC: 1994
Ensembl: ENSG00000104879
Pharos: P06732(Tbio)
UniProt: P06732 B2R892
Structure
Position
19:complement(45306413..45322875)
AA seq 381 aa
MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTG
VDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDD
LDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMT
EKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISM
EKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLA
HLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLM
VEMEKKLEKGQSIDDMIPAQK
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgccattcggtaacacccacaacaagttcaagctgaattacaagcctgaggaggagtac
cccgacctcagcaaacataacaaccacatggccaaggtactgacccttgaactctacaag
aagctgcgggacaaggagactccatctggcttcactgtagacgatgtcatccagacagga
gtggacaacccaggtcaccccttcatcatgaccgtgggctgcgtggctggtgatgaggag
tcctacgaagttttcaaggaactctttgaccccatcatctcggatcgccacgggggctac
aaacccactgacaagcacaagactgacctcaaccatgaaaacctcaagggtggagacgac
ctggaccctaactacgtgctcagcagccgcgtccgcactggccgcagcatcaagggctac
acgttgcccccacactgctcccgtggcgagcgccgggcggtggagaagctctctgtggaa
gctctcaacagcctgacgggcgagttcaaagggaagtactaccctctgaagagcatgacg
gagaaggagcagcagcagctcatcgatgaccacttcctgttcgacaagcccgtgtccccg
ctgctgctggcctcaggcatggcccgcgactggcccgacgcccgtggcatctggcacaat
gacaacaagagcttcctggtgtgggtgaacgaggaggatcacctccgggtcatctccatg
gagaaggggggcaacatgaaggaggttttccgccgcttctgcgtagggctgcagaagatt
gaggagatctttaagaaagctggccaccccttcatgtggaaccagcacctgggctacgtg
ctcacctgcccatccaacctgggcactgggctgcgtggaggcgtgcatgtgaagctggcg
cacctgagcaagcaccccaagttcgaggagatcctcacccgcctgcgtctgcagaagagg
ggtacaggtggcgtggacacagctgccgtgggctcagtatttgacgtgtccaacgctgat
cggctgggctcgtccgaagtagaacaggtgcagctggtggtggatggtgtgaagctcatg
gtggaaatggagaagaagttggagaaaggccagtccattgacgacatgatccccgcccag
aagtag

DBGET integrated database retrieval system