KEGG   Homo sapiens (human): 115827Help
Entry
115827            CDS       T01001                                 

Gene name
RAB3C
Definition
(RefSeq) RAB3C, member RAS oncogene family
  KO
K07883  Ras-related protein Rab-3C
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    115827 (RAB3C)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    115827 (RAB3C)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab GTPases
    115827 (RAB3C)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab3/27 [OT]
    115827 (RAB3C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf SRPRB GTP_EFTU MMR_HSR1 Gtr1_RagA DUF2757 Septin AAA_16
Motif
Other DBs
NCBI-GeneID: 115827
NCBI-ProteinID: NP_612462
OMIM: 612829
HGNC: 30269
Ensembl: ENSG00000152932
Vega: OTTHUMG00000097053
Pharos: Q96E17(Tbio)
UniProt: Q96E17
Position
5q11.2
AA seq 227 aa AA seqDB search
MRHEAPMQMASAQDARYGQKDSSDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFV
STVGIDFKVKTVFKNEKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNA
VQDWSTQIKTYSWDNAQVILVGNKCDMEDERVISTERGQHLGEQLGFEFFETSAKDNINV
KQTFERLVDIICDKMSESLETDPAITAAKQNTRLKETPPPPQPNCAC
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgagacacgaagcgcccatgcagatggcctctgcccaagatgccaggtacggccagaaa
gactcctctgatcagaactttgactacatgttcaaattactcatcatcggcaatagcagt
gtggggaaaacatcttttctattccgttatgcagatgactcctttacatctgcattcgtc
agcacagttgggatcgatttcaaagtaaaaactgtattcaaaaatgaaaagagaatcaag
cttcagatttgggacacagcaggccaggaaagatacaggactatcaccacagcctattat
cgtggagccatgggctttattttaatgtatgacattacaaatgaagaatccttcaatgca
gtacaagattggtcaactcaaatcaaaacatactcttgggacaatgcccaagttattctg
gttgggaacaagtgtgacatggaagacgagcgggtcatctcaactgagcgaggtcaacat
ttaggagaacagcttgggtttgagttttttgaaacaagtgccaaggacaacattaatgtc
aagcagacatttgagcgccttgtggatatcatctgcgacaaaatgtcagagagtttggag
actgatcctgccatcactgctgcaaagcagaacacgagactcaaggaaactcctcctcca
ccgcagcccaactgtgcctgctag

DBGET integrated database retrieval system