KEGG   Homo sapiens (human): 115861
Entry
115861            CDS       T01001                                 
Symbol
NXNL1, RDCVF, TXNL6
Name
(RefSeq) nucleoredoxin like 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Thioredoxin_8 Redoxin AhpC-TSA Thioredoxin TraF Thioredoxin_2 Thioredoxin_7 Thioredoxin_9 UPF0547
Other DBs
NCBI-GeneID: 115861
NCBI-ProteinID: NP_612463
OMIM: 608791
HGNC: 25179
Ensembl: ENSG00000171773
UniProt: Q96CM4
Position
19:complement(17455425..17460926)
AA seq 212 aa
MASLFSGRILIRNNSDQDELDTEAEVSRRLENRLVLLFFGAGACPQCQAFVPILKDFFVR
LTDEFYVLRAAQLALVYVSQDSTEEQQDLFLKDMPKKWLFLPFEDDLRRDLGRQFSVERL
PAVVVLKPDGDVLTRDGADEIQRLGTACFANWQEAAEVLDRNFQLPEDLEDQEPRSLTEC
LRRHKYRVEKAARGGRDPGGGGGEEGGAGGLF
NT seq 639 nt   +upstreamnt  +downstreamnt
atggcctccctgttctctggccgcatcctgatccgcaacaatagcgaccaggacgagctg
gatacggaggctgaggtcagtcgcaggctggagaaccggctggtgctgctgttctttggt
gctggggcttgtccacagtgccaggccttcgtgcccatcctcaaggacttcttcgtgcgg
ctcacagatgagttctatgtactgcgggcggctcagctggccctggtgtacgtgtcccag
gactccacggaggagcagcaggacctgttcctcaaggacatgccaaagaaatggcttttc
ctgccctttgaggatgatctgaggagggacctcgggcgccagttctcagtggagcgcctg
ccggcggtcgtggtgctcaagccggacggggacgtgctcactcgcgacggcgccgacgag
atccagcgcctgggcaccgcctgcttcgccaactggcaggaggcggccgaggtgctggac
cgcaacttccagctgccagaggacctggaggaccaggagccacggagcctcaccgagtgc
ctgcgccgccacaagtaccgcgtggaaaaggcggcgcgaggcgggcgcgaccccggggga
gggggtggggaggagggcggggccggggggctgttctga

DBGET integrated database retrieval system