KEGG   Homo sapiens (human): 115992Help
Entry
115992            CDS       T01001                                 

Gene name
RNF166
Definition
(RefSeq) ring finger protein 166
  KO
K17044  RING finger protein 166
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    115992 (RNF166)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    115992 (RNF166)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-Di19 zf_C2HC_14 zf-C3HC4_2 zf-RING_UBOX zf-RING_5 zf-C3HC4 zf-RING_2 zf-C3HC4_3 zf-RING_6 zf-C3HC4_4 UIM Prok-RING_4 zf-rbx1 U-box zf-ANAPC11 zinc_ribbon_2 zf-ribbon_3 zf-C2H2_4
Motif
Other DBs
NCBI-GeneID: 115992
NCBI-ProteinID: NP_849163
OMIM: 617178
HGNC: 28856
Ensembl: ENSG00000158717
Vega: OTTHUMG00000137863
Pharos: Q96A37(Tdark)
UniProt: Q96A37
Position
16q24.2-q24.3
AA seq 237 aa AA seqDB search
MAMFRSLVASAQQRQPPAGPAGGDSGLEAQYTCPICLEVYHRPVAIGSCGHTFCGECLQP
CLQVPSPLCPLCRLPFDPKKVDKATHVEKQLSSYKAPCRGCNKKVTLAKMRVHISSCLKV
QEQMANCPKFVPVVPTSQPIPSNIPNRSTFACPYCGARNLDQQELVKHCVESHRSDPNRV
VCPICSAMPWGDPSYKSANFLQHLLHRHKFSYDTFVDYSIDEEAAFQAALALSLSEN
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atggctatgttccgcagcctggtggcctcggctcagcagcggcagccgccggccgggccg
gcgggcggcgacagcggcctggaggcgcagtacacctgccccatctgcctggaggtctat
caccggcccgtggccatcggcagctgcggccacacgttctgcggggagtgtctccagccc
tgcctgcaggtgccatccccgctgtgcccactctgccgcctgcccttcgaccccaagaag
gtggacaaggccacccacgtggagaagcagctctcatcctacaaagcgccctgtcgaggc
tgcaacaaaaaggtgaccctggcaaagatgagagtgcacatttcgtcctgcctgaaggtc
caggagcagatggccaactgccccaagttcgtccccgtggtgcccacatcacagcctatc
cccagcaacatccccaacaggtccaccttcgcctgcccgtactgtggtgcccgcaacctg
gaccagcaggagctggtgaagcactgtgtggaaagccaccgcagcgaccccaaccgcgtg
gtgtgccccatctgctcggcaatgccctggggggaccccagctacaagagcgccaacttc
ctgcagcacctgcttcaccgacacaagttctcctacgacacctttgtggactacagtatt
gacgaggaggccgccttccaggctgctctggccctgtctctctctgagaactga

DBGET integrated database retrieval system