KEGG   Homo sapiens (human): 116071Help
Entry
116071            CDS       T01001                                 

Gene name
BATF2, SARI
Definition
(RefSeq) basic leucine zipper ATF-like transcription factor 2
  KO
K09034  ATF-like basic leucine zipper transcriptional factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    116071 (BATF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    116071 (BATF2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    116071 (BATF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf HALZ HAP1_N DivIC DUF3287
Motif
Other DBs
NCBI-GeneID: 116071
NCBI-ProteinID: NP_612465
OMIM: 614983
HGNC: 25163
Ensembl: ENSG00000168062
Vega: OTTHUMG00000165633
Pharos: Q8N1L9(Tbio)
UniProt: Q8N1L9
Position
11q13.1
AA seq 274 aa AA seqDB search
MHLCGGNGLLTQTDPKEQQRQLKKQKNRAAAQRSRQKHTDKADALHQQHESLEKDNLALR
KEIQSLQAELAWWSRTLHVHERLCPMDCASCSAPGLLGCWDQAEGLLGPGPQGQHGCREQ
LELFQTPGSCYPAQPLSPGPQPHDSPSLLQCPLPSLSLGPAVVAEPPVQLSPSPLLFASH
TGSSLQGSSSKLSALQPSLTAQTAPPQPLELEHPTRGKLGSSPDNPSSALGLARLQSREH
KPALSAATWQGLVVDPSPHPLLAFPLLSSAQVHF
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgcacctctgtgggggcaatgggctgctgacccagacagaccccaaggagcaacaaagg
cagctgaagaagcagaagaaccgggcagccgcccagcgaagccggcagaagcacacagac
aaggcagacgccctgcaccagcagcacgagtctctggaaaaagacaacctcgccctgcgg
aaggagatccagtccctgcaggccgagctggcgtggtggagccggaccctgcacgtgcat
gagcgcctgtgccccatggattgtgcctcctgctcagctccagggctcctgggctgctgg
gaccaggctgaggggctcctgggccctggcccacagggacaacatggctgccgggagcag
ctggagctgttccagaccccgggttcctgttacccagctcagccgctctctccaggtcca
cagcctcatgattctcccagcctcctccagtgccccctgccctcactgtcccttggcccc
gctgtggttgctgaacctcctgtccagctgtcccccagccctctcctgtttgcctcgcac
actggttccagcctgcaggggtcttcctctaagctcagtgccctccagcccagcctcacg
gcccaaactgcccctccacagcccctcgagctggagcatcccaccagagggaagctgggg
tcctctcccgacaacccttcctctgccctggggcttgcacgtctgcagagcagggagcac
aaacctgctctctcagcagccacttggcaagggctggttgtggatcccagccctcaccct
ctcctggcctttcctctgctctcctctgctcaagtccacttctaa

DBGET integrated database retrieval system