KEGG   Homo sapiens (human): 116085Help
Entry
116085            CDS       T01001                                 

Gene name
SLC22A12, OAT4L, RST, URAT1
Definition
(RefSeq) solute carrier family 22 member 12
  KO
K08208  MFS transporter, OCT family, solute carrier family 22 (organic anion/cation transporter), member 12
Organism
hsa  Homo sapiens (human)
Disease
H00948  Renal hypouricemia
Drug target
Benzbromarone: D01056
Lesinurad (DG01388): D09921 D09922
Verinurad: D11129
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    116085 (SLC22A12)
   04147 Exosome [BR:hsa04147]
    116085 (SLC22A12)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC22: Organic cation/anion/zwitterion transporter
   116085 (SLC22A12)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Organic cation transporter (OCT) family [TC:2.A.1.19]
    116085 (SLC22A12)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   116085 (SLC22A12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MFS_1 Sugar_tr
Motif
Other DBs
NCBI-GeneID: 116085
NCBI-ProteinID: NP_653186
OMIM: 607096
HGNC: 17989
Ensembl: ENSG00000197891
Vega: OTTHUMG00000045213
Pharos: Q96S37(Tclin)
UniProt: Q96S37
Position
11q13.1
AA seq 553 aa AA seqDB search
MAFSELLDLVGGLGRFQVLQTMALMVSIMWLCTQSMLENFSAAVPSHRCWAPLLDNSTAQ
ASILGSLSPEALLAISIPPGPNQRPHQCRRFRQPQWQLLDPNATATSWSEADTEPCVDGW
VYDRSIFTSTIVAKWNLVCDSHALKPMAQSIYLAGILVGAAACGPASDRFGRRLVLTWSY
LQMAVMGTAAAFAPAFPVYCLFRFLLAFAVAGVMMNTGTLLMEWTAARARPLVMTLNSLG
FSFGHGLTAAVAYGVRDWTLLQLVVSVPFFLCFLYSWWLAESARWLLTTGRLDWGLQELW
RVAAINGKGAVQDTLTPEVLLSAMREELSMGQPPASLGTLLRMPGLRFRTCISTLCWFAF
GFTFFGLALDLQALGSNIFLLQMFIGVVDIPAKMGALLLLSHLGRRPTLAASLLLAGLCI
LANTLVPHEMGALRSALAVLGLGGVGAAFTCITIYSSELFPTVLRMTAVGLGQMAARGGA
ILGPLVRLLGVHGPWLPLLVYGTVPVLSGLAALLLPETQSLPLPDTIQDVQNQAVKKATH
GTLGNSVLKSTQF
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggcattttctgaactcctggacctcgtgggtggcctgggcaggttccaggttctccag
acgatggctctgatggtctccatcatgtggctgtgtacccagagcatgctggagaacttc
tcggccgccgtgcccagccaccgctgctgggcacccctcctggacaacagcacggctcag
gccagcatcctagggagcttgagtcctgaggccctcctggctatttccatcccgccgggc
cccaaccagaggccccaccagtgccgccgcttccgccagccacagtggcagctcttggac
cccaatgccacggccaccagctggagcgaggccgacacggagccgtgtgtggatggctgg
gtctatgaccgcagcatcttcacctccacaatcgtggccaagtggaacctcgtgtgtgac
tctcatgctctgaagcccatggcccagtccatctacctggctgggattctggtgggagct
gctgcgtgcggccctgcctcagacaggtttgggcgcaggctggtgctaacctggagctac
cttcagatggctgtgatgggtacggcagctgccttcgcccctgccttccccgtgtactgc
ctgttccgcttcctgttggcctttgccgtggcaggcgtcatgatgaacacgggcactctc
ctgatggagtggacggcggcacgggcccgacccttggtgatgaccttgaactctctgggc
ttcagcttcggccatggcctgacagctgcagtggcctacggtgtgcgggactggacactg
ctgcagctggtggtctcggtccccttcttcctctgctttttgtactcctggtggctggca
gagtcggcacgatggctcctcaccacaggcaggctggattggggcctgcaggagctgtgg
agggtggctgccatcaacggaaagggggcagtgcaggacaccctgacccctgaggtcttg
ctttcagccatgcgggaggagctgagcatgggccagcctcctgccagcctgggcaccctg
ctccgcatgcccggactgcgcttccggacctgtatctccacgttgtgctggttcgccttt
ggcttcaccttcttcggcctggccctggacctgcaggccctgggcagcaacatcttcctg
ctccaaatgttcattggtgtcgtggacatcccagccaagatgggcgccctgctgctgctg
agccacctgggccgccgccccacgctggccgcatccctgttgctggcagggctctgcatt
ctggccaacacgctggtgccccacgaaatgggggctctgcgctcagccttggccgtgctg
gggctgggcggggtgggggctgccttcacctgcatcaccatctacagcagcgagctcttc
cccactgtgctcaggatgacggcagtgggcttgggccagatggcagcccgtggaggagcc
atcctggggcctctggtccggctgctgggtgtccatggcccctggctgcccttgctggtg
tatgggacggtgccagtgctgagtggcctggccgcactgcttctgcccgagacccagagc
ttgccgctgcccgacaccatccaagatgtgcagaaccaggcagtaaagaaggcaacacat
ggcacgctggggaactctgtcctaaaatccacacagttttag

DBGET integrated database retrieval system