KEGG   Homo sapiens (human): 116085
Entry
116085            CDS       T01001                                 

Symbol
SLC22A12, OAT4L, RST, URAT1
Name
(RefSeq) solute carrier family 22 member 12
  KO
K08208  MFS transporter, OCT family, solute carrier family 22 (organic anion/cation transporter), member 12
Organism
hsa  Homo sapiens (human)
Disease
H00948  Renal hypouricemia
Drug target
Benzbromarone: D01056<JP>
Lesinurad (DG01388): D09921 D09922
Verinurad: D11129
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    116085 (SLC22A12)
   04147 Exosome [BR:hsa04147]
    116085 (SLC22A12)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC22: Organic cation/anion/zwitterion transporter
   116085 (SLC22A12)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Organic cation transporter (OCT) family [TC:2.A.1.19]
    116085 (SLC22A12)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   116085 (SLC22A12)
SSDB
Motif
Pfam: MFS_1 Sugar_tr
Other DBs
NCBI-GeneID: 116085
NCBI-ProteinID: NP_653186
OMIM: 607096
HGNC: 17989
Ensembl: ENSG00000197891
Vega: OTTHUMG00000045213
Pharos: Q96S37(Tclin)
UniProt: Q96S37
Position
11q13.1
AA seq 553 aa
MAFSELLDLVGGLGRFQVLQTMALMVSIMWLCTQSMLENFSAAVPSHRCWAPLLDNSTAQ
ASILGSLSPEALLAISIPPGPNQRPHQCRRFRQPQWQLLDPNATATSWSEADTEPCVDGW
VYDRSIFTSTIVAKWNLVCDSHALKPMAQSIYLAGILVGAAACGPASDRFGRRLVLTWSY
LQMAVMGTAAAFAPAFPVYCLFRFLLAFAVAGVMMNTGTLLMEWTAARARPLVMTLNSLG
FSFGHGLTAAVAYGVRDWTLLQLVVSVPFFLCFLYSWWLAESARWLLTTGRLDWGLQELW
RVAAINGKGAVQDTLTPEVLLSAMREELSMGQPPASLGTLLRMPGLRFRTCISTLCWFAF
GFTFFGLALDLQALGSNIFLLQMFIGVVDIPAKMGALLLLSHLGRRPTLAASLLLAGLCI
LANTLVPHEMGALRSALAVLGLGGVGAAFTCITIYSSELFPTVLRMTAVGLGQMAARGGA
ILGPLVRLLGVHGPWLPLLVYGTVPVLSGLAALLLPETQSLPLPDTIQDVQNQAVKKATH
GTLGNSVLKSTQF
NT seq 1662 nt   +upstreamnt  +downstreamnt
atggcattttctgaactcctggacctcgtgggtggcctgggcaggttccaggttctccag
acgatggctctgatggtctccatcatgtggctgtgtacccagagcatgctggagaacttc
tcggccgccgtgcccagccaccgctgctgggcacccctcctggacaacagcacggctcag
gccagcatcctagggagcttgagtcctgaggccctcctggctatttccatcccgccgggc
cccaaccagaggccccaccagtgccgccgcttccgccagccacagtggcagctcttggac
cccaatgccacggccaccagctggagcgaggccgacacggagccgtgtgtggatggctgg
gtctatgaccgcagcatcttcacctccacaatcgtggccaagtggaacctcgtgtgtgac
tctcatgctctgaagcccatggcccagtccatctacctggctgggattctggtgggagct
gctgcgtgcggccctgcctcagacaggtttgggcgcaggctggtgctaacctggagctac
cttcagatggctgtgatgggtacggcagctgccttcgcccctgccttccccgtgtactgc
ctgttccgcttcctgttggcctttgccgtggcaggcgtcatgatgaacacgggcactctc
ctgatggagtggacggcggcacgggcccgacccttggtgatgaccttgaactctctgggc
ttcagcttcggccatggcctgacagctgcagtggcctacggtgtgcgggactggacactg
ctgcagctggtggtctcggtccccttcttcctctgctttttgtactcctggtggctggca
gagtcggcacgatggctcctcaccacaggcaggctggattggggcctgcaggagctgtgg
agggtggctgccatcaacggaaagggggcagtgcaggacaccctgacccctgaggtcttg
ctttcagccatgcgggaggagctgagcatgggccagcctcctgccagcctgggcaccctg
ctccgcatgcccggactgcgcttccggacctgtatctccacgttgtgctggttcgccttt
ggcttcaccttcttcggcctggccctggacctgcaggccctgggcagcaacatcttcctg
ctccaaatgttcattggtgtcgtggacatcccagccaagatgggcgccctgctgctgctg
agccacctgggccgccgccccacgctggccgcatccctgttgctggcagggctctgcatt
ctggccaacacgctggtgccccacgaaatgggggctctgcgctcagccttggccgtgctg
gggctgggcggggtgggggctgccttcacctgcatcaccatctacagcagcgagctcttc
cccactgtgctcaggatgacggcagtgggcttgggccagatggcagcccgtggaggagcc
atcctggggcctctggtccggctgctgggtgtccatggcccctggctgcccttgctggtg
tatgggacggtgccagtgctgagtggcctggccgcactgcttctgcccgagacccagagc
ttgccgctgcccgacaccatccaagatgtgcagaaccaggcagtaaagaaggcaacacat
ggcacgctggggaactctgtcctaaaatccacacagttttag

DBGET integrated database retrieval system