KEGG   Homo sapiens (human): 1161Help
Entry
1161              CDS       T01001                                 

Gene name
ERCC8, CKN1, CSA, UVSS2
Definition
(RefSeq) ERCC excision repair 8, CSA ubiquitin ligase complex subunit
  KO
K10570  DNA excision repair protein ERCC-8
Organism
hsa  Homo sapiens (human)
Pathway
hsa03420  Nucleotide excision repair
hsa04120  Ubiquitin mediated proteolysis
Disease
H00076  Cockayne syndrome
H00403  Disorders of nucleotide excision repair
H02131  UV-sensitive syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    1161 (ERCC8)
  09124 Replication and repair
   03420 Nucleotide excision repair
    1161 (ERCC8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    1161 (ERCC8)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    1161 (ERCC8)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     1161 (ERCC8)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      1161 (ERCC8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 Nup160 DUF4859
Motif
Other DBs
NCBI-GeneID: 1161
NCBI-ProteinID: NP_000073
OMIM: 609412
HGNC: 3439
Ensembl: ENSG00000049167
Vega: OTTHUMG00000097741
Pharos: Q13216(Tbio)
UniProt: Q13216
Structure
PDB: 

Position
5q12.1
AA seq 396 aa AA seqDB search
MLGFLSARQTGLEDPLRLRRAESTRRVLGLELNKDRDVERIHGGGINTLDIEPVEGRYML
SGGSDGVIVLYDLENSSRQSYYTCKAVCSIGRDHPDVHRYSVETVQWYPHDTGMFTSSSF
DKTLKVWDTNTLQTADVFNFEETVYSHHMSPVSTKHCLVAVGTRGPKVQLCDLKSGSCSH
ILQGHRQEILAVSWSPRYDYILATASADSRVKLWDVRRASGCLITLDQHNGKKSQAVESA
NTAHNGKVNGLCFTSDGLHLLTVGTDNRMRLWNSSNGENTLVNYGKVCNNSKKGLKFTVS
CGCSSEFVFVPYGSTIAVYTVYSGEQITMLKGHYKTVDCCVFQSNFQELYSGSRDCNILA
WVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEEG
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgctggggtttttgtccgcacgccaaacgggtttggaggaccctcttcgccttcggaga
gcagagtcaacacggagagttttgggactggaattaaataaagacagagatgttgaaaga
atccacggcggtggaattaacacccttgacattgaacctgttgaagggagatacatgtta
tcaggtggttcagatggtgtgattgtactttatgaccttgagaactccagcagacaatct
tattacacatgtaaagcagtgtgttccattggcagagatcatcctgatgttcacagatac
agtgtggagactgtacagtggtatcctcatgacactggcatgttcacatcaagctcattt
gataaaactctgaaagtatgggatacaaatacattacaaactgcagatgtatttaatttt
gaggaaacagtttatagtcatcatatgtctccagtctccaccaagcactgtttggtagca
gttggtactagaggacccaaagtacaactttgtgacttgaagtctggatcctgttctcac
attctacagggtcacagacaagaaatattagcagtttcctggtctccacgttatgactat
atcttggcaacagcaagtgctgacagtagagtaaaattatgggatgtgagaagagcatca
ggatgtttgattactcttgatcaacataatgggaaaaagtcacaagctgttgaatcagca
aacactgctcataatgggaaagttaatggcttatgttttacaagtgatggacttcacctc
ctcactgttggtacagataatcgaatgaggctctggaatagttccaatggagaaaacaca
cttgtgaactatggaaaagtttgtaataacagtaaaaaaggattgaaattcactgtctcc
tgtggctgcagttcagaatttgtttttgtaccatatggtagcaccattgctgtttataca
gtttactcaggagaacagataactatgcttaagggacattataaaactgttgactgctgt
gtatttcagtcaaatttccaggaactttatagtggtagcagagactgcaacattctggct
tgggttccatccttatatgaaccagttcctgatgatgatgagactacaacaaaatcacaa
ttaaatccggcctttgaagatgcctggagcagcagtgatgaagaaggatga

DBGET integrated database retrieval system