KEGG   Homo sapiens (human): 116173
Entry
116173            CDS       T01001                                 
Symbol
CMTM5, CKLFSF5
Name
(RefSeq) CKLF like MARVEL transmembrane domain containing 5
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: MARVEL
Other DBs
NCBI-GeneID: 116173
NCBI-ProteinID: NP_001275675
OMIM: 607888
HGNC: 19176
Ensembl: ENSG00000166091
Pharos: Q96DZ9(Tbio)
UniProt: Q96DZ9
Position
14:23376771..23379772
AA seq 223 aa
MLSARDRRDRHPEEGVVAELQGFAVDKAFLTSHKGILLETELALTLIIFICFTASISAYM
AAALLEFFITLAFLFLYATQYYQRFDRINWPCLLQGHGQSGGPHPLDLLSHSAKVQPQPW
PGLTPPGWHTPAAVPWVPAPAPGFWSWLLWFICFHSLGSSDFLRCVSAIIIFLVVSFAAV
TSRDGAAIAAFVFGIILVSIFAYDAFKIYRTEMAPGASQGDQQ
NT seq 672 nt   +upstreamnt  +downstreamnt
atgctcagtgctcgagatcgccgggaccggcaccctgaggagggggtagttgcagagctc
cagggcttcgcggtggacaaggccttcctcacctcccacaagggcatcctgctggaaacc
gagctggccctgaccctcatcatcttcatctgcttcacggcctccatctctgcctacatg
gccgcggcgctactggagttcttcatcacacttgccttcctcttcctctatgccacccag
tactaccagcgcttcgaccgaattaactggccctgtctgctgcagggccacgggcaatca
ggaggaccacatccgctagatctactctcccactcagcaaaggtccagccccagccctgg
cctggcttgacccccccgggctggcatactccagccgctgtcccctgggttccagcccca
gcgcctggcttctggtcctggttgctctggttcatctgcttccactccctgggtagcagt
gacttcctgcgctgtgtcagtgccatcatcatcttcctggtggtctcctttgcagctgtg
acctcccgggacggagctgccattgctgcttttgtttttggcatcatcctggtttccatc
tttgcctatgatgccttcaagatctaccggactgagatggcacccggggccagccagggg
gaccagcagtga

DBGET integrated database retrieval system