KEGG   Homo sapiens (human): 116211Help
Entry
116211            CDS       T01001                                 

Gene name
TM4SF19, OCTM4
Definition
(RefSeq) transmembrane 4 L six family member 19
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: L6_membrane
Motif
Other DBs
NCBI-GeneID: 116211
NCBI-ProteinID: NP_612470
HGNC: 25167
Ensembl: ENSG00000145107
Vega: OTTHUMG00000155675
Pharos: Q96DZ7(Tdark)
UniProt: Q96DZ7
Position
3q29
AA seq 209 aa AA seqDB search
MVSSPCTQASSRTCSRILGLSLGTAALFAAGANVALLLPNWDVTYLLRGLLGRHAMLGTG
LWGGGLMVLTAAILISLMGWRYGCFSKSGLCRSVLTALLSGGLALLGALICFVTSGVALK
DGPFCMFDVSSFNQTQAWKYGYPFKDLHSRNYLYDRSLWNSVCLEPSAAVVWHVSLFSAL
LCISLLQLLLVVVHVINSLLGLFCSLCEK
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcctctccctgcacgcaggcaagctcacggacttgctcccgtatcctgggactg
agccttgggactgcagccctgtttgctgctggggccaacgtggcactcctccttcctaac
tgggatgtcacctacctgttgaggggcctccttggcaggcatgccatgctgggaactggg
ctctggggaggaggcctcatggtactcactgcagctatcctcatctccttgatgggctgg
agatacggctgcttcagtaagagtgggctctgtcgaagcgtgcttactgctctgttgtca
ggtggcctggctttacttggagccctgatttgctttgtcacttctggagttgctctgaaa
gatggtcctttttgcatgtttgatgtttcatccttcaatcagacacaagcttggaaatat
ggttacccattcaaagacctgcatagtaggaattatctgtatgaccgttcgctctggaac
tccgtctgcctggagccctctgcagctgttgtctggcacgtgtccctcttctccgccctt
ctgtgcatcagcctgctccagcttctcctggtggtcgttcatgtcatcaacagcctcctg
ggccttttctgcagcctctgcgagaagtga

DBGET integrated database retrieval system