KEGG   Homo sapiens (human): 116228
Entry
116228            CDS       T01001                                 

Gene name
COX20, FAM36A, MC4DN11
Definition
(RefSeq) cytochrome c oxidase assembly factor COX20
  KO
K18184  cytochrome c oxidase assembly protein subunit 20
Organism
hsa  Homo sapiens (human)
Pathway
hsa04714  Thermogenesis
Disease
H01368  Cytochrome c oxidase (COX) deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    116228 (COX20)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    116228 (COX20)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    116228 (COX20)
SSDB
Motif
Pfam: DUF3767 TMIE
Other DBs
NCBI-GeneID: 116228
NCBI-ProteinID: NP_001299800
OMIM: 614698
HGNC: 26970
Ensembl: ENSG00000203667
Vega: OTTHUMG00000040401
Pharos: Q5RI15(Tbio)
UniProt: Q5RI15 B3KM21
Position
1q44
AA seq 118 aa
MAAPPEPGEPEERKSLKLLGFLDVENTPCARHSILYGSLGSVVAGFGHFLFTSRIRRSCD
VGVGGFILVTLGCWFHCRYNYAKQRIQERIAREEIKKKILYEGTHLDPERKHNGSSSN
NT seq 357 nt   +upstreamnt  +downstreamnt
atggccgccccgccggagcccggtgagcccgaggagaggaagtcccttaagctcctagga
tttttagatgttgaaaatactccctgcgcccggcattcaatattgtatggttcattagga
tctgttgtggctggctttggacattttttgttcactagtagaattagaagatcatgtgat
gttggagtaggagggtttatcttggtgactttgggatgctggtttcattgtaggtataat
tatgcaaagcaaagaatccaggaaagaattgccagagaagaaattaaaaagaagatatta
tatgaaggtacccacctcgatcctgaaagaaaacacaacggcagcagcagcaattga

DBGET integrated database retrieval system