KEGG   Homo sapiens (human): 116236Help
Entry
116236            CDS       T01001                                 

Gene name
ABHD15
Definition
(RefSeq) abhydrolase domain containing 15
  KO
K13707  abhydrolase domain-containing protein 15
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    116236 (ABHD15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4
Motif
Other DBs
NCBI-GeneID: 116236
NCBI-ProteinID: NP_937790
HGNC: 26971
Ensembl: ENSG00000168792
Vega: OTTHUMG00000179721
Pharos: Q6UXT9(Tdark)
UniProt: Q6UXT9
Position
17q11.2
AA seq 468 aa AA seqDB search
MPPWGAALALILAVLALLGLLGPRLRGPWGRAVGERTLPGAQDRDDGEEADGGGPADQFS
DGREPLPGGCSLVCKPSALAQCLLRALRRSEALEAGPRSWFSGPHLQTLCHFVLPVAPGP
ELAREYLQLADDGLVALDWVVGPCVRGRRITSAGGLPAVLLVIPNAWGRLTRNVLGLCLL
ALERGYYPVIFHRRGHHGCPLVSPRLQPFGDPSDLKEAVTYIRFRHPAAPLFAVSEGSGS
ALLLSYLGECGSSSYVTGAACISPVLRCREWFEAGLPWPYERGFLLHQKIALSRYATALE
DTVDTSRLFRSRSLREFEEALFCHTKSFPISWDTYWDRNDPLRDVDEAAVPVLCICSADD
PVCGPPDHTLTTELFHSNPYFFLLLSRHGGHCGFLRQEPLPAWSHEVILESFRALTEFFR
TEERIKGLSRHRASFLGGRRRGGALQRREVSSSSNLEEIFNWKRSYTR
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgtggggcgccgccctcgcgctcatcttggccgtgctcgcccttctcggcctg
ctcggcccgcggctccggggaccctgggggcgcgccgtcggagagaggaccctgccgggg
gcccaagaccgagacgacggggaggaggcggacggcggaggcccggcggaccagttcagc
gacgggcgcgagccactgccgggagggtgcagccttgtttgcaagccgtcggccctggcc
cagtgcctgctgcgcgccctgcggcgctcagaggcgctggaggccggcccgcgctcctgg
ttctccgggccccacctgcagaccctctgccacttcgtcctgcccgtagcgcctgggcct
gagctggcccgggagtacctgcagttggcggacgatgggctagtggccctggactgggtg
gtaggaccttgtgttcggggccgccggatcaccagcgccgggggccttcctgcggtgctt
ctggtgatccccaatgcgtggggtcgcctcacccgcaacgtgctcggcctttgcttgctc
gccctggagcgcggctactacccggtcatcttccatcgccgcggccaccacggttgccca
ctggtcagcccccggctgcagcctttcggggacccgtccgacctcaaggaggcggtcaca
tacatccgcttccgacacccggcggcgccgctgttcgcggtgagcgaaggctcgggctcg
gcgctgctcctgtcctacctgggcgagtgcggctcctccagctacgtgacaggcgccgcc
tgcatctcgcccgtgctgcgctgccgagagtggttcgaggccggcctgccctggccctac
gagcggggctttctgctccaccagaagatcgccctcagcaggtatgccacagccctggag
gacactgtggacaccagcagactgttcaggagccgttcccttcgagagtttgaggaggct
ctcttctgccacaccaaaagcttccccatcagctgggatacctactgggaccgcaacgac
ccgctccgggatgtcgatgaggcagccgtgcctgtgctgtgtatctgcagtgctgacgac
cccgtgtgtggacccccagaccacactctgacaactgaactcttccacagcaacccctac
ttcttcctcctgctcagtcgccacggaggccactgtggcttcctgcgccaggagcccttg
ccagcctggagccatgaggtcatcttggagtccttccgggccttgactgagttcttccga
acggaggagaggattaaagggctgagcaggcacagagcttccttccttgggggccgtcgt
cgtgggggagccttgcagaggcgggaagtctcttcctcttccaacctggaggagatcttt
aactggaagcgatcatacacaaggtga

DBGET integrated database retrieval system