KEGG   Homo sapiens (human): 116369Help
Entry
116369            CDS       T01001                                 

Gene name
SLC26A8, SPGF3, TAT1
Definition
(RefSeq) solute carrier family 26 member 8
  KO
K14705  solute carrier family 26 (testis anion transporter), member 8
Organism
hsa  Homo sapiens (human)
Disease
H01282  Spermatogenic failure
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    116369 (SLC26A8)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC26: Multifunctional anion exchanger
   116369 (SLC26A8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sulfate_transp STAS NESP55 Trypan_PARP KRTDAP
Motif
Other DBs
NCBI-GeneID: 116369
NCBI-ProteinID: NP_001180405
OMIM: 608480
HGNC: 14468
Ensembl: ENSG00000112053
Vega: OTTHUMG00000014586
Pharos: Q96RN1(Tbio)
UniProt: Q96RN1 A0A024RCV0
Position
6p21.31
AA seq 970 aa AA seqDB search
MAQLERSAISGFSSKSRRNSFAYDVKREVYNEETFQQEHKRKASSSGNMNINITTFRHHV
QCRCSWHRFLRCVLTIFPFLEWMCMYRLKDWLLGDLLAGISVGLVQVPQGLTLSLLARQL
IPPLNIAYAAFCSSVIYVIFGSCHQMSIGSFFLVSALLINVLKVSPFNNGQLVMGSFVKN
EFSAPSYLMGYNKSLSVVATTTFLTGIIQLIMGVLGLGFIATYLPESAMSAYLAAVALHI
MLSQLTFIFGIMISFHAGPISFFYDIINYCVALPKANSTSILVFLTVVVALRINKCIRIS
FNQYPIEFPMELFLIIGFTVIANKISMATETSQTLIDMIPYSFLLPVTPDFSLLPKIILQ
AFSLSLVSSFLLIFLGKKIASLHNYSVNSNQDLIAIGLCNVVSSFFRSCVFTGAIARTII
QDKSGGRQQFASLVGAGVMLLLMVKMGHFFYTLPNAVLAGIILSNVIPYLETISNLPSLW
RQDQYDCALWMMTFSSSIFLGLDIGLIISVVSAFFITTVRSHRAKILLLGQIPNTNIYRS
INDYREIITIPGVKIFQCCSSITFVNVYYLKHKLLKEVDMVKVPLKEEEIFSLFNSSDTN
LQGGKICRCFCNCDDLEPLPRILYTERFENKLDPEASSINLIHCSHFESMNTSQTASEDQ
VPYTVSSVSQKNQGQQYEEVEEVWLPNNSSRNSSPGLPDVAESQGRRSLIPYSDASLLPS
VHTIILDFSMVHYVDSRGLVVLRQICNAFQNANILILIAGCHSSIVRAFERNDFFDAGIT
KTQLFLSVHDAVLFALSRKVIGSSELSIDESETVIRETYSETDKNDNSRYKMSSSFLGSQ
KNVSPGFIKIQQPVEEESELDLELESEQEAGLGLDLDLDRELEPEMEPKAETETKTQTEM
EPQPETEPEMEPNPKSRPRAHTFPQQRYWPMYHPSMASTQSQTQTRTWSVERRRHPMDSY
SPEGNSNEDV
NT seq 2913 nt NT seq  +upstreamnt  +downstreamnt
atggcacaactagagaggagcgccatctctggcttcagctctaagtccaggcgaaactca
ttcgcatatgatgttaagcgtgaagtatacaatgaggagacctttcaacaggaacacaaa
aggaaggcctcctcttctgggaacatgaacatcaacatcaccaccttcagacaccacgtc
cagtgccgctgctcatggcacaggttcctacgatgcgtgcttacaatctttcccttccta
gaatggatgtgtatgtatcgattaaaggattggcttctgggagacttacttgctggtata
agtgttggccttgtgcaagttccccaaggcctgacacttagtttgctggcaaggcaactg
attcctcctctcaacatcgcttatgcagctttctgttcttcggtaatctatgtaattttt
ggatcgtgtcatcaaatgtccattggttccttcttcctggtgagtgctctgctgatcaac
gttctgaaagtgagcccattcaacaacggtcaactggtcatgggatctttcgtcaagaat
gagttttcggccccctcctaccttatgggctataataaatccttgagtgtggtggcaacc
acaacttttctgactgggattattcagctaataatgggcgtattgggtttgggcttcatt
gccacttaccttccggagtctgcaatgagtgcttacctggctgctgtggcacttcatatc
atgctgtcccagctgactttcatctttgggattatgattagtttccatgccggtcccatc
tccttcttctatgacataattaattactgtgtagctctcccaaaagcgaattccaccagc
attctagtatttctaactgttgttgttgctctgcgaatcaacaaatgtatcagaatttct
ttcaatcagtatcccattgagtttcccatggaattatttctgattattggcttcactgtg
attgcaaacaagataagcatggccacagaaaccagccagacgcttattgacatgattcct
tatagctttctgcttcctgtaacaccagatttcagccttcttcccaagataattttacaa
gccttctccttatctttggtgagctcctttctgctcatatttctgggcaagaagattgcc
agtcttcacaattacagtgtcaattccaaccaggatttaatagccatcggcctttgcaat
gtcgtcagttcatttttcagatcttgtgtgtttactggtgctattgctaggactattatc
caggataaatctggaggaagacaacagtttgcatctctggtaggcgcaggtgtgatgctg
ctcctgatggtgaagatgggacactttttctacacactgccaaatgctgtgctggctggt
attattctgagcaacgtcattccctaccttgaaaccatttctaacctacccagcctgtgg
aggcaggaccaatatgactgtgctctttggatgatgacattctcatcttcaattttcctg
ggactggacattggactaattatctcagtagtttctgctttcttcatcaccactgttcgt
tcacacagagctaagattcttctcctgggtcaaatccctaacaccaacatttatagaagc
atcaatgattatcgggagatcatcaccattcctggggtgaaaatcttccagtgctgcagc
tcaattacatttgtaaatgtttactacctaaagcataagctgttaaaagaggttgatatg
gtaaaggtgcctcttaaagaagaagaaattttcagcttgtttaattcaagtgacaccaat
ctacaaggaggaaagatttgcaggtgtttctgcaactgtgatgatctggagccgctgccc
aggattctttacacagagcgatttgaaaataaactggatcccgaagcatcctccattaac
ctgattcactgctcacattttgagagcatgaacacaagccaaactgcatccgaagaccaa
gtgccatacacagtatcgtccgtgtctcagaaaaatcaagggcaacagtatgaggaggtg
gaggaagtttggcttcctaataactcatcaagaaacagctcaccaggactgcctgatgtg
gcggaaagccaggggaggagatcactcatcccttactcagatgcgtctctactgcccagt
gtccacaccatcatcctggatttctccatggtacactacgtggattcacgggggttagtc
gtattaagacagatatgcaatgcctttcaaaacgccaacattttgatactcattgcaggg
tgtcactcttccatagtcagggcatttgagaggaatgatttctttgacgctggcatcacc
aagacccagctgttcctcagcgttcacgacgccgtgctgtttgccttgtcaaggaaggtc
ataggctcctctgagttaagcatcgatgaatccgagacagtgatacgggaaacctactca
gaaacagacaagaatgacaattcaagatataaaatgagcagcagttttctaggaagccaa
aaaaatgtaagtccaggcttcatcaagatccaacagcctgtagaagaggagtcggagttg
gatttggagctggaatcagaacaagaggctgggctgggtctggacctagacctggatcgg
gagctggagcctgaaatggagcccaaggctgagaccgagaccaagacccagaccgagatg
gagccccagcctgagactgagcctgagatggagcccaaccccaaatctaggccaagagct
cacacttttcctcagcagcgttactggcctatgtatcatccgtctatggcttccacccag
tctcagactcagactcggacatggtcagtggagaggagacgccatcctatggattcatac
tcaccagagggcaacagcaatgaagatgtctag

DBGET integrated database retrieval system