KEGG   Homo sapiens (human): 116379Help
Entry
116379            CDS       T01001                                 

Gene name
IL22RA2, CRF2-10, CRF2-S1, CRF2X, IL-22BP, IL-22R-alpha-2, IL-22RA2, ZCYTOR16
Definition
(RefSeq) interleukin 22 receptor subunit alpha 2
  KO
K05139  interleukin 22 receptor alpha 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    116379 (IL22RA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    116379 (IL22RA2)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL10/28 receptor family
   116379 (IL22RA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tissue_fac Interfer-bind Receptor_2B4
Motif
Other DBs
NCBI-GeneID: 116379
NCBI-ProteinID: NP_443194
OMIM: 606648
HGNC: 14901
Ensembl: ENSG00000164485
Vega: OTTHUMG00000015655
Pharos: Q969J5(Tbio)
UniProt: Q969J5
Structure
PDB: 

Position
6q23.3
AA seq 263 aa AA seqDB search
MMPKHCFLGFLISFFLTGVAGTQSTHESLKPQRVQFQSRNFHNILQWQPGRALTGNSSVY
FVQYKIMFSCSMKSSHQKPSGCWQHISCNFPGCRTLAKYGQRQWKNKEDCWGTQELSCDL
TSETSDIQEPYYGRVRAASAGSYSEWSMTPRFTPWWETKIDPPVMNITQVNGSLLVILHA
PNLPYRYQKEKNVSIEDYYELLYRVFIINNSLEKEQKVYEGAHRAVEIEALTPHSSYCVV
AEIYQPMLDRRSQRSEERCVEIP
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgatgcctaaacattgctttctaggcttcctcatcagtttcttccttactggtgtagca
ggaactcagtcaacgcatgagtctctgaagcctcagagggtacaatttcagtcccgaaat
tttcacaacattttgcaatggcagcctgggagggcacttactggcaacagcagtgtctat
tttgtgcagtacaaaatcatgttctcatgcagcatgaaaagctctcaccagaagccaagt
ggatgctggcagcacatttcttgtaacttcccaggctgcagaacattggctaaatatgga
cagagacaatggaaaaataaagaagactgttggggtactcaagaactctcttgtgacctt
accagtgaaacctcagacatacaggaaccttattacgggagggtgagggcggcctcggct
gggagctactcagaatggagcatgacgccgcggttcactccctggtgggaaacaaaaata
gatcctccagtcatgaatataacccaagtcaatggctctttgttggtaattctccatgct
ccaaatttaccatatagataccaaaaggaaaaaaatgtatctatagaagattactatgaa
ctactataccgagtttttataattaacaattcactagaaaaggagcaaaaggtttatgaa
ggggctcacagagcggttgaaattgaagctctaacaccacactccagctactgtgtagtg
gctgaaatatatcagcccatgttagacagaagaagtcagagaagtgaagagagatgtgtg
gaaattccatga

DBGET integrated database retrieval system