KEGG   Homo sapiens (human): 116442
Entry
116442            CDS       T01001                                 

Gene name
RAB39B, BGMR, MRX72, WSMN, WSN
Definition
(RefSeq) RAB39B, member RAS oncogene family
  KO
K07925  Ras-related protein Rab-39B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04140  Autophagy - animal
Disease
H00480  X-linked mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    116442 (RAB39B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    116442 (RAB39B)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    116442 (RAB39B)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Other autophagy associated proteins
   Rab GTPases
    116442 (RAB39B)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab39/42 [OT]
    116442 (RAB39B)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA GTP_EFTU CENP-M AAA_22 TniB
Other DBs
NCBI-GeneID: 116442
NCBI-ProteinID: NP_741995
OMIM: 300774 311510
HGNC: 16499
Ensembl: ENSG00000155961
Vega: OTTHUMG00000022659
Pharos: Q96DA2(Tbio)
UniProt: Q96DA2
Position
Xq28
AA seq 213 aa
MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKL
QIWDTAGQERFRSITRAYYRNSVGGLLLFDITNRRSFQNVHEWLEETKVHVQPYQIVFVL
VGHKCDLDTQRQVTRHEAEKLAAAYGMKYIETSARDAINVEKAFTDLTRDIYELVKRGEI
TIQEGWEGVKSGFVPNVVHSSEEVVKSERRCLC
NT seq 642 nt   +upstreamnt  +downstreamnt
atggaggccatctggctgtaccagttccggctcattgtcatcggggattccacagtgggc
aagtcctgcctgatccgccgcttcaccgagggtcgctttgcccaggtttctgaccccacc
gtgggggtggattttttctcccgcttggtggagatcgagccaggaaaacgcatcaagctc
cagatctgggataccgcgggtcaagagaggttcagatccatcactcgcgcctactacagg
aactcagtaggtggtcttctcttatttgacattaccaaccgcaggtccttccagaatgtc
catgagtggttagaagagaccaaagtacacgttcagccctaccaaattgtatttgttctg
gtgggtcacaagtgtgacctggatacacagaggcaagtgactcgccacgaggccgagaaa
ctggctgctgcatacggcatgaagtacattgaaacgtcagcccgagatgccattaatgtg
gagaaagccttcacagacctgacaagagacatatatgagctggttaaaaggggggagatt
acaatccaggagggctgggaaggggtgaagagtggatttgtaccaaatgtggttcactct
tcagaagaggttgtcaaatcagagaggagatgtttgtgctag

DBGET integrated database retrieval system