KEGG   Homo sapiens (human): 116447Help
Entry
116447            CDS       T01001                                 

Gene name
TOP1MT
Definition
(RefSeq) DNA topoisomerase I mitochondrial
  KO
K03163  DNA topoisomerase I [EC:5.6.2.1]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    116447 (TOP1MT)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.1  DNA topoisomerase
     116447 (TOP1MT)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Topoisomerases
   116447 (TOP1MT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Topoisom_I Topoisom_I_N Topo_C_assoc DUF4407
Motif
Other DBs
NCBI-GeneID: 116447
NCBI-ProteinID: NP_443195
OMIM: 606387
HGNC: 29787
Ensembl: ENSG00000184428
Vega: OTTHUMG00000164979
Pharos: Q969P6(Tclin)
UniProt: Q969P6 E5KMK7
Position
8q24.3
AA seq 601 aa AA seqDB search
MRVVRLLRLRAALTLLGEVPRRPASRGVPGSRRTQKGSGARWEKEKHEDGVKWRQLEHKG
PYFAPPYEPLPDGVRFFYEGRPVRLSVAAEEVATFYGRMLDHEYTTKEVFRKNFFNDWRK
EMAVEEREVIKSLDKCDFTEIHRYFVDKAAARKVLSREEKQKLKEEAEKLQQEFGYCILD
GHQEKIGNFKIEPPGLFRGRGDHPKMGMLKRRITPEDVVINCSRDSKIPEPPAGHQWKEV
RSDNTVTWLAAWTESVQNSIKYIMLNPCSKLKGETAWQKFETARRLRGFVDEIRSQYRAD
WKSREMKTRQRAVALYFIDKLALRAGNEKEDGEAADTVGCCSLRVEHVQLHPEADGCQHV
VEFDFLGKDCIRYYNRVPVEKPVYKNLQLFMENKDPRDDLFDRLTTTSLNKHLQELMDGL
TAKVFRTYNASITLQEQLRALTRAEDSIAAKILSYNRANRVVAILCNHQRATPSTFEKSM
QNLQTKIQAKKEQVAEARAELRRARAEHKAQGDGKSRSVLEKKRRLLEKLQEQLAQLSVQ
ATDKEENKQVALGTSKLNYLDPRISIAWCKRFRVPVEKIYSKTQRERFAWALAMAGEDFE
F
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtggtgcggctgctgcggctccgggcggctctgacgctgctcggggaggtcccc
cgccgcccggcctcccggggtgtcccgggctcgcgcaggacgcagaagggcagtggagcc
aggtgggagaaggagaagcacgaagacggggtgaagtggagacagctggagcacaagggc
ccgtacttcgcacccccatacgagccccttcccgacggagtgcgtttcttctatgaagga
aggcctgtgagattgagcgtggcagcggaggaggtcgccactttttatgggaggatgtta
gatcatgaatacacaacaaaggaggttttccggaagaacttcttcaatgactggcgaaag
gaaatggcggtggaagagagggaagtcatcaagagcctggacaagtgtgacttcacggag
atccacagatactttgtggacaaggccgcagcccggaaagtcctgagcagggaggagaag
cagaagctaaaagaagaggcagaaaaacttcagcaagagttcggctactgtattttagat
ggtcaccaagaaaaaataggcaacttcaagattgagccgcctggcttgttccgtggccgt
ggcgaccatcccaagatggggatgctgaagagaaggatcacgccagaggatgtggttatc
aactgcagcagggactcgaagatccccgagccgccggcggggcaccagtggaaggaggtg
cgctccgataacaccgtcacgtggctggcagcttggaccgagagcgttcagaactccatc
aagtacatcatgctgaacccttgctcgaagctgaagggggagacagcttggcagaagttt
gaaacagctcgacgcctgcggggatttgtggacgagatccgctcccagtaccgggctgac
tggaagtctcgggaaatgaagacgagacagcgggcggtggccctgtatttcatcgataag
ctggcactgagagcaggaaatgagaaggaggacggtgaggcggccgacaccgtgggctgc
tgttccctccgcgtggagcacgtccagctgcacccggaggccgatggctgccaacacgtg
gtggaatttgacttcctggggaaggactgcatccgctactacaacagagtgccggtggag
aagccggtgtacaagaacttacagctctttatggagaacaaggacccccgggacgacctc
ttcgacaggctgaccacgaccagcctgaacaagcacctccaggagctgatggacgggctg
acggccaaggtgttccggacctacaacgcctccatcactctgcaggagcagctgcgggcc
ctgacgcgcgccgaggacagcatagcagctaagatcttatcctacaaccgagccaaccga
gtcgtggccattctctgcaaccatcagcgagcaacccccagtacgttcgagaagtcgatg
cagaatctccagacgaagatccaggcaaagaaggagcaggtggctgaggccagggcagag
ctgaggagggcgagggctgagcacaaagcccaaggggatggcaagtccaggagtgtcctg
gagaagaagaggcggctcctggagaagctgcaggagcagctggcgcagctgagtgtgcag
gccacggacaaggaggagaacaagcaggtggccctgggcacgtccaagctcaactacctg
gaccccaggatcagcattgcctggtgcaagcggttcagggtgccagtggagaagatctac
agcaaaacacagcgggagaggttcgcctgggctctcgccatggcaggagaagactttgaa
ttctaa

DBGET integrated database retrieval system