KEGG   Homo sapiens (human): 116448
Entry
116448            CDS       T01001                                 

Gene name
OLIG1, BHLHB6, BHLHE21
Definition
(RefSeq) oligodendrocyte transcription factor 1
  KO
K09085  class B basic helix-loop-helix protein 1/6/7
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    116448 (OLIG1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Tal/Twist/Atonal/Hen, Atonal
    116448 (OLIG1)
SSDB
Motif
Pfam: HLH DUF3446 DUF1283 Metal_resist
Other DBs
NCBI-GeneID: 116448
NCBI-ProteinID: NP_620450
OMIM: 606385
HGNC: 16983
Ensembl: ENSG00000184221
Vega: OTTHUMG00000065064
Pharos: Q8TAK6(Tbio)
UniProt: Q8TAK6
Position
21q22.11
AA seq 271 aa
MYYAVSQARVNAVPGTMLRPQRPGDLQLGASLYELVGYRQPPSSSSSSTSSTSSTSSSST
TAPLLPKAAREKPEAPAEPPGPGPGSGAHPGGSARPDAKEEQQQQLRRKINSRERKRMQD
LNLAMDALREVILPYSAAHCQGAPGRKLSKIATLLLARNYILLLGSSLQELRRALGEGAG
PAAPRLLLAGLPLLAAAPGSVLLAPGAVGPPDALRPAKYLSLALDEPPCGQFALPGGGAG
GPGLCTCAVCKFPHLVPASLGLAAVQAQFSK
NT seq 816 nt   +upstreamnt  +downstreamnt
atgtactatgcggtttcccaggcgcgcgtgaacgcggtccccgggaccatgctgcggcca
cagcggcccggagacttgcagctcggggcctccctctacgagctggtgggctacaggcag
ccgccctcctcctcctcctcctccacctcctccacctcctccacttcctcctcctccacg
acggcccccctcctccccaaggctgcgcgcgagaagccggaggcgccggccgagcctcca
ggccccgggcccgggtcaggcgcgcacccgggcggcagcgcccggccggacgccaaggag
gagcagcagcagcagctgcggcgcaagatcaacagccgcgagcggaagcgcatgcaggac
ctgaacctggccatggacgccctgcgcgaggtcatcctgccctactcagcggcgcactgc
cagggcgcgcccggccgcaagctctccaagatagccacgctgctgctcgcccgcaactac
atcctactgctgggcagctcgctgcaggagctgcgccgcgcgctgggcgagggcgccggg
cccgccgcgccgcgcctgctgctggccgggctgcccctgctcgccgccgcgcccggctcc
gtgctgctggcgcccggcgccgtaggaccccccgacgcgctgcgccccgccaagtacctg
tcgctggcgctggacgagccgccgtgcggccagttcgctctccccggcggcggcgcaggc
ggccccggcctctgcacctgcgccgtgtgcaagttcccgcacctggtcccggccagcctg
ggcctggccgccgtgcaggcgcaattctccaagtga

DBGET integrated database retrieval system