KEGG   Homo sapiens (human): 116512Help
Entry
116512            CDS       T01001                                 

Gene name
MRGPRD, MRGD, TGR7
Definition
(RefSeq) MAS related GPR family member D
  KO
K08392  Mas-related G protein-coupled receptor member D
Organism
hsa  Homo sapiens (human)
Pathway
hsa04614  Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    116512 (MRGPRD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    116512 (MRGPRD)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Others
   Mas proto-oncogene and Mas-related (MRGs)
    116512 (MRGPRD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 116512
NCBI-ProteinID: NP_944605
OMIM: 607231
HGNC: 29626
Ensembl: ENSG00000172938
Vega: OTTHUMG00000167896
Pharos: Q8TDS7(Tbio)
UniProt: Q8TDS7
Position
11q13.3
AA seq 321 aa AA seqDB search
MNQTLNSSGTVESALNYSRGSTVHTAYLVLSSLAMFTCLCGMAGNSMVIWLLGFRMHRNP
FCIYILNLAAADLLFLFSMASTLSLETQPLVNTTDKVHELMKRLMYFAYTVGLSLLTAIS
TQRCLSVLFPIWFKCHRPRHLSAWVCGLLWTLCLLMNGLTSSFCSKFLKFNEDRCFRVDM
VQAALIMGVLTPVMTLSSLTLFVWVRRSSQQWRRQPTRLFVVVLASVLVFLICSLPLSIY
WFVLYWLSLPPEMQVLCFSLSRLSSSVSSSANPVIYFLVGSRRSHRLPTRSLGTVLQQAL
REEPELEGGETPTVGTNEMGA
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagactttgaatagcagtgggaccgtggagtcagccctaaactattccagaggg
agcacagtgcacacggcctacctggtgctgagctccctggccatgttcacctgcctgtgc
gggatggcaggcaacagcatggtgatctggctgctgggctttcgaatgcacaggaacccc
ttctgcatctatatcctcaacctggcggcagccgacctcctcttcctcttcagcatggct
tccacgctcagcctggaaacccagcccctggtcaataccactgacaaggtccacgagctg
atgaagagactgatgtactttgcctacacagtgggcctgagcctgctgacggccatcagc
acccagcgctgtctctctgtcctcttccctatctggttcaagtgtcaccggcccaggcac
ctgtcagcctgggtgtgtggcctgctgtggacactctgtctcctgatgaacgggttgacc
tcttccttctgcagcaagttcttgaaattcaatgaagatcggtgcttcagggtggacatg
gtccaggccgccctcatcatgggggtcttaaccccagtgatgactctgtccagcctgacc
ctctttgtctgggtgcggaggagctcccagcagtggcggcggcagcccacacggctgttc
gtggtggtcctggcctctgtcctggtgttcctcatctgttccctgcctctgagcatctac
tggtttgtgctctactggttgagcctgccgcccgagatgcaggtcctgtgcttcagcttg
tcacgcctctcctcgtccgtaagcagcagcgccaaccccgtcatctacttcctggtgggc
agccggaggagccacaggctgcccaccaggtccctggggactgtgctccaacaggcgctt
cgcgaggagcccgagctggaaggtggggagacgcccaccgtgggcaccaatgagatgggg
gcttga

DBGET integrated database retrieval system