KEGG   Homo sapiens (human): 116519Help
Entry
116519            CDS       T01001                                 

Gene name
APOA5, APOAV, RAP3
Definition
(RefSeq) apolipoprotein A5
  KO
K09025  apolipoprotein A-V
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
Disease
H00157  Hyperlipoproteinemia, type V
H01635  Hyperlipidemia
H01784  Primary hyperchylomicronemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    116519 (APOA5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    116519 (APOA5)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Others
   116519 (APOA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Apolipoprotein Exonuc_VII_L YtxH TraC_F_IV DUF1664 ACP_PD BAG6
Motif
Other DBs
NCBI-GeneID: 116519
NCBI-ProteinID: NP_001160070
OMIM: 606368
HGNC: 17288
Ensembl: ENSG00000110243
Vega: OTTHUMG00000046116
Pharos: Q6Q788(Tbio)
UniProt: Q6Q788 A0A0B4RUS7
Position
11q23.3
AA seq 366 aa AA seqDB search
MASMAAVLTWALALLSAFSATQARKGFWDYFSQTSGDKGRVEQIHQQKMAREPATLKDSL
EQDLNNMNKFLEKLRPLSGSEAPRLPQDPVGMRRQLQEELEEVKARLQPYMAEAHELVGW
NLEGLRQQLKPYTMDLMEQVALRVQELQEQLRVVGEDTKAQLLGGVDEAWALLQGLQSRV
VHHTGRFKELFHPYAESLVSGIGRHVQELHRSVAPHAPASPARLSRCVQVLSRKLTLKAK
ALHARIQQNLDQLREELSRAFAGTGTEEGAGPDPQMLSEEVRQRLQAFRQDTYLQIAAFT
RAIDQETEEVQQQLAPPPPGHSAFAPEFQQTDSGKVLSKLQARLDDLWEDITHSLHDQGH
SHLGDP
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcatggctgccgtgctcacctgggctctggctcttctttcagcgttttcggcc
acccaggcacggaaaggcttctgggactacttcagccagaccagcggggacaaaggcagg
gtggagcagatccatcagcagaagatggctcgcgagcccgcgaccctgaaagacagcctt
gagcaagacctcaacaatatgaacaagttcctggaaaagctgaggcctctgagtgggagc
gaggctcctcggctcccacaggacccggtgggcatgcggcggcagctgcaggaggagttg
gaggaggtgaaggctcgcctccagccctacatggcagaggcgcacgagctggtgggctgg
aatttggagggcttgcggcagcaactgaagccctacacgatggatctgatggagcaggtg
gccctgcgcgtgcaggagctgcaggagcagttgcgcgtggtgggggaagacaccaaggcc
cagttgctggggggcgtggacgaggcttgggctttgctgcagggactgcagagccgcgtg
gtgcaccacaccggccgcttcaaagagctcttccacccatacgccgagagcctggtgagc
ggcatcgggcgccacgtgcaggagctgcaccgcagtgtggctccgcacgcccccgccagc
cccgcgcgcctcagtcgctgcgtgcaggtgctctcccggaagctcacgctcaaggccaag
gccctgcacgcacgcatccagcagaacctggaccagctgcgcgaagagctcagcagagcc
tttgcaggcactgggactgaggaaggggccggcccggacccccagatgctctccgaggag
gtgcgccagcgacttcaggctttccgccaggacacctacctgcagatagctgccttcact
cgcgccatcgaccaggagactgaggaggtccagcagcagctggcgccacctccaccaggc
cacagtgccttcgccccagagtttcaacaaacagacagtggcaaggttctgagcaagctg
caggcccgtctggatgacctgtgggaagacatcactcacagccttcatgaccagggccac
agccatctgggggacccctga

DBGET integrated database retrieval system