KEGG   Homo sapiens (human): 116832
Entry
116832            CDS       T01001                                 
Symbol
RPL39L, L39-2, RPL39L1
Name
(RefSeq) ribosomal protein L39 like
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Ribosomal_L39
Other DBs
NCBI-GeneID: 116832
NCBI-ProteinID: NP_443201
OMIM: 607547
HGNC: 17094
Ensembl: ENSG00000163923
Pharos: Q96EH5(Tbio)
UniProt: Q96EH5
Position
3:complement(187120948..187139496)
AA seq 51 aa
MSSHKTFTIKRFLAKKQKQNRPIPQWIQMKPGSKIRYNSKRRHWRRTKLGL
NT seq 156 nt   +upstreamnt  +downstreamnt
atgtcttctcacaagactttcaccattaagcgattcctggccaagaaacaaaagcaaaat
cgtcccatcccccagtggattcagatgaaacctggtagtaaaatcaggtacaactccaaa
aggaggcattggagaagaaccaagctgggtctataa

DBGET integrated database retrieval system