KEGG   Homo sapiens (human): 116835
Entry
116835            CDS       T01001                                 

Gene name
HSPA12B, C20orf60
Definition
(RefSeq) heat shock protein family A (Hsp70) member 12B
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: HSP70
Other DBs
NCBI-GeneID: 116835
NCBI-ProteinID: NP_443202
OMIM: 610702
HGNC: 16193
Ensembl: ENSG00000132622
Vega: OTTHUMG00000031755
Pharos: Q96MM6(Tbio)
UniProt: Q96MM6
Position
20p13
AA seq 686 aa
MLAVPEMGLQGLYIGSSPERSPVPSPPGSPRTQESCGIAPLTPSQSPKPEVRAPQQASFS
VVVAIDFGTTSSGYAFSFASDPEAIHMMRKWEGGDPGVAHQKTPTCLLLTPEGAFHSFGY
TARDYYHDLDPEEARDWLYFEKFKMKIHSATDLTLKTQLEAVNGKTMPALEVFAHALRFF
REHALQELREQSPSLPEKDTVRWVLTVPAIWKQPAKQFMREAAYLAGLVSRENAEQLLIA
LEPEAASVYCRKLRLHQLLDLSGRAPGGGRLGERRSIDSSFRQAREQLRRSRHSRTFLVE
SGVGELWAEMQAGDRYVVADCGGGTVDLTVHQLEQPHGTLKELYKASGGPYGAVGVDLAF
EQLLCRIFGEDFIATFKRQRPAAWVDLTIAFEARKRTAGPHRAGALNISLPFSFIDFYRK
QRGHNVETALRRSSVNFVKWSSQGMLRMSCEAMNELFQPTVSGIIQHIEALLARPEVQGV
KLLFLVGGFAESAVLQHAVQAALGARGLRVVVPHDVGLTILKGAVLFGQAPGVVRVRRSP
LTYGVGVLNRFVPGRHPPEKLLVRDGRRWCTDVFERFVAAEQSVALGEEVRRSYCPARPG
QRRVLINLYCCAAEDARFITDPGVRKCGALSLELEPADCGQDTAGAPPGRREIRAAMQFG
DTEIKVTAVDVSTNRSVRASIDFLSN
NT seq 2061 nt   +upstreamnt  +downstreamnt
atgttggctgtcccggagatgggcctgcaggggctgtacatcggctccagcccggagcgg
tccccagtgcctagcccacccggctccccgaggacccaggaaagctgcggcattgccccc
ctcacaccctcgcagtctccaaaacccgaggtccgagccccccagcaggcctccttctct
gtggtggtggccattgacttcggcaccacgtctagtggctatgctttcagctttgccagt
gaccctgaggccatccacatgatgaggaaatgggagggcggagacccgggcgtggcccac
cagaagaccccgacctgcctgctgctgactccggagggcgccttccacagctttggctac
accgcccgcgattactaccatgacctggaccccgaagaggcgcgggactggctctacttc
gagaagttcaagatgaagatccacagcgccacggatctcaccttgaagacccagctagag
gcagtaaatggaaagacgatgcccgccctggaggtgttcgcccatgccctgcgcttcttc
agggagcacgcccttcaggagctgagggagcagagcccatcgctgccagagaaggacact
gtgcgctgggtgttgacggtgcctgccatctggaaacagccagccaagcagttcatgcgg
gaggctgcctacctggctggactagtgtcccgagagaatgcagagcagctactcatcgcc
ctggagcccgaggccgcctcggtatactgccgcaagctgcgcctgcaccagctcctggac
ctgagtggccgggccccaggtggtgggcgcctgggtgagcgccgctccatcgactccagc
ttccgtcaggctcgggagcagctgcgaaggtcccgccacagccgcacgttcctggtggag
tcaggcgtaggagagctgtgggcagagatgcaagcaggagaccgctacgtggtggccgac
tgcggcggaggcaccgtggacctgacggtgcaccagctggagcagccccatggcaccctc
aaggagctctacaaggcatctgggggcccttatggcgcggtgggcgtggacctggccttc
gagcagctgctgtgccgcatcttcggcgaggacttcatcgccaccttcaaaaggcaacgg
ccggcagcctgggtagatctgaccatcgccttcgaggctcgcaagcgcactgctggccca
caccgtgcaggggcgctcaacatctcgctgcccttctccttcattgacttctaccgcaag
cagcggggccacaacgtggagaccgctctgcgcaggagcagcgtgaacttcgtgaagtgg
tcctcacaggggatgctccgaatgtcttgtgaagccatgaacgagctctttcagcccacc
gtcagcgggatcatccagcacatagaggccctgctggcacggccggaggtgcagggtgtg
aagctgctgttcctagtgggcggcttcgccgagtcagcggtgctgcagcacgcggtgcag
gcggcgctgggcgcccgcggtctgcgtgtcgtggtcccgcacgacgtgggcctcaccatc
ctcaaaggcgcggtgctgttcggccaggcgccgggcgtggtgcgggtccgccgctcgccg
ctcacctatggcgtgggcgtgctcaaccgctttgtgcctgggcgccacccgcccgaaaag
ctgctggttcgcgacggccgccgctggtgcaccgacgtcttcgagcgcttcgtggccgcc
gagcagtcggtggccctgggcgaggaggtgcggcgcagctactgcccggcgcgtcccggc
cagcggcgcgtactcatcaacctgtactgctgcgcggcagaggatgcgcgcttcatcacc
gaccccggcgtgcgcaaatgcggcgcgctcagcctcgagcttgagcccgccgactgcggc
caggacaccgccggcgcgcctcccggccgccgcgagatccgcgccgccatgcagtttggc
gacaccgaaattaaggtcaccgccgtcgacgtcagcaccaatcgctccgtgcgcgcgtcc
atcgactttctttccaactga

DBGET integrated database retrieval system