KEGG   Homo sapiens (human): 116844
Entry
116844            CDS       T01001                                 

Symbol
LRG1, HMFT1766, LRG
Name
(RefSeq) leucine rich alpha-2-glycoprotein 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_1 LRRCT
Other DBs
NCBI-GeneID: 116844
NCBI-ProteinID: NP_443204
OMIM: 611289
HGNC: 29480
Ensembl: ENSG00000171236
Vega: OTTHUMG00000182010
Pharos: P02750(Tbio)
UniProt: P02750 Q68CK4
Position
19p13.3
AA seq 347 aa
MSSWSRQRPKSPGGIQPHVSRTLFLLLLLAASAWGVTLSPKDCQVFRSDHGSSISCQPPA
EIPGYLPADTVHLAVEFFNLTHLPANLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRV
LDLTRNALTGLPPGLFQASATLDTLVLKENQLEVLEVSWLHGLKALGHLDLSGNRLRKLP
PGLLANFTLLRTLDLGENQLETLPPDLLRGPLQLERLHLEGNKLQVLGKDLLLPQPDLRY
LFLNGNKLARVAAGAFQGLRQLDMLDLSNNSLASVPEGLWASLGQPNWDMRDGFDISGNP
WICDQNLSDLYRWLQAQKDKMFSQNDTRCAGPEAVKGQTLLAVAKSQ
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgtcctcttggagcagacagcgaccaaaaagcccagggggcattcaaccccatgtttct
agaactctgttcctgctgctgctgttggcagcctcagcctggggggtcaccctgagcccc
aaagactgccaggtgttccgctcagaccatggcagctccatctcctgtcaaccacctgcc
gaaatccccggctacctgccagccgacaccgtgcacctggccgtggaattcttcaacctg
acccacctgccagccaacctcctccagggcgcctctaagctccaagaattgcacctctcc
agcaatgggctggaaagcctctcgcccgaattcctgcggccagtgccgcagctgagggtg
ctggatctaacccgaaacgccctgaccgggctgcccccgggcctcttccaggcctcagcc
accctggacaccctggtattgaaagaaaaccagctggaggtcctggaggtctcgtggcta
cacggcctgaaagctctggggcatctggacctgtctgggaaccgcctccggaaactgccc
cccgggctgctggccaacttcaccctcctgcgcacccttgaccttggggagaaccagttg
gagaccttgccacctgacctcctgaggggtccgctgcaattagaacggctacatctagaa
ggcaacaaattgcaagtactgggaaaagatctcctcttgccgcagccggacctgcgctac
ctcttcctgaacggcaacaagctggccagggtggcagccggtgccttccagggcctgcgg
cagctggacatgctggacctctccaataactcactggccagcgtgcccgaggggctctgg
gcatccctagggcagccaaactgggacatgcgggatggcttcgacatctccggcaacccc
tggatctgtgaccagaacctgagcgacctctatcgttggcttcaggcccaaaaagacaag
atgttttcccagaatgacacgcgctgtgctgggcctgaagccgtgaagggccagacgctc
ctggcagtggccaagtcccagtga

DBGET integrated database retrieval system