KEGG   Homo sapiens (human): 116983Help
Entry
116983            CDS       T01001                                 

Gene name
ACAP3, CENTB5
Definition
(RefSeq) ArfGAP with coiled-coil, ankyrin repeat and PH domains 3
  KO
K12489  Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    116983 (ACAP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    116983 (ACAP3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    116983 (ACAP3)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    116983 (ACAP3)
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    116983 (ACAP3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   116983 (ACAP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BAR_3 ArfGap PH Ank_5 Ank_2 Ank_3 Ank_4 Ank PH_11 BAR Exonuc_VII_L PH_8
Motif
Other DBs
NCBI-GeneID: 116983
NCBI-ProteinID: NP_085152
HGNC: 16754
Ensembl: ENSG00000131584
Vega: OTTHUMG00000002235
Pharos: Q96P50(Tdark)
UniProt: Q96P50 Q8WTZ1
Position
1p36.33
AA seq 834 aa AA seqDB search
MTVEFEECVKDSPRFRATIDEVETDVVEIEAKLDKLVKLCSGMVEAGKAYVSTSRLFVSG
VRDLSQQCQGDTVISECLQRFADSLQEVVNYHMILFDQAQRSVRQQLQSFVKEDVRKFKE
TKKQFDKVREDLELSLVRNAQAPRHRPHEVEEATGALTLTRKCFRHLALDYVLQINVLQA
KKKFEILDSMLSFMHAQSSFFQQGYSLLHQLDPYMKKLAAELDQLVIDSAVEKREMERKH
AAIQQRTLLQDFSYDESKVEFDVDAPSGVVMEGYLFKRASNAFKTWNRRWFSIQNSQLVY
QKKLKDALTVVVDDLRLCSVKPCEDIERRFCFEVLSPTKSCMLQADSEKLRQAWVQAVQA
SIASAYRESPDSCYSERLDRTASPSTSSIDSATDTRERGVKGESVLQRVQSVAGNSQCGD
CGQPDPRWASINLGVLLCIECSGIHRSLGVHCSKVRSLTLDSWEPELLKLMCELGNSAVN
QIYEAQCEGAGSRKPTASSSRQDKEAWIKDKYVEKKFLRKAPMAPALEAPRRWRVQKCLR
PHSSPRAPTARRKVRLEPVLPCVAALSSVGTLDRKFRRDSLFCPDELDSLFSYFDAGAAG
AGPRSLSSDSGLGGSSDGSSDVLAFGSGSVVDSVTEEEGAESEESSGEADGDTEAEAWGL
ADVRELHPGLLAHRAARARDLPALAAALAHGAEVNWADAEDEGKTPLVQAVLGGSLIVCE
FLLQNGADVNQRDSRGRAPLHHATLLGRTGQVCLFLKRGADQHALDQEQRDPLAIAVQAA
NADIVTLLRLARMAEEMREAEAAPGPPGALAGSPTELQFRRCIQEFISLHLEES
NT seq 2505 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtggagttcgaggagtgcgtcaaggactccccgcgcttcagggcgaccattgac
gaggtggagacggacgtggtggagattgaggccaaactggacaagctggtgaagctgtgc
agtggcatggtggaagccggtaaggcctacgtcagcaccagcaggcttttcgtgagcggc
gtccgcgacctgtcccagcagtgccagggcgacaccgtcatctcggaatgtctgcagagg
ttcgctgacagcctacaggaggtggtgaactaccacatgatcctgtttgaccaggcccag
aggtccgtgcggcagcagctccagagctttgtcaaagaggatgtgcggaagttcaaggag
acaaagaagcagtttgacaaggtgcgggaggacctggagctgtccctggtgaggaacgcc
caggccccgaggcaccggccccacgaggtggaggaagccaccggggccctcaccctcacc
aggaagtgcttccgccacctggcactggactatgtgctccagatcaatgttctgcaggcc
aagaagaagtttgagatcctggactctatgctgtccttcatgcacgcccagtccagcttc
ttccagcagggctacagcctcctgcaccagctggacccctacatgaagaagctggcagcc
gagctggaccagctggtgatcgactctgcggtggaaaagcgtgagatggagcgaaagcac
gccgccatccagcagcggacgctgctgcaggacttctcctacgatgagtccaaagtggag
tttgacgtggacgcgcccagtggggtggtgatggagggctacctcttcaagagggccagc
aacgctttcaagacatggaaccggcgctggttctccattcagaacagccagctggtctac
cagaagaagctcaaggatgccctcaccgtggtggtggatgacctccgcctgtgctctgtg
aagccgtgtgaggacatcgagcggaggttctgcttcgaggtgctgtcacccaccaagagc
tgcatgctgcaggctgactccgagaagctgcggcaagcctgggtccaggctgtgcaggcc
agcatcgcctccgcctaccgcgagagccctgacagttgctatagcgagaggctggaccgc
acagcatccccgtccacgagcagcatcgactccgccaccgacactcgggagcgtggcgtg
aagggcgagagtgtgctgcagcgtgtgcagagtgtggccggcaacagccagtgcggcgac
tgcggccagccggacccccgctgggccagcatcaacctgggcgtgctgctctgcattgag
tgctccggcatccacaggagcctgggtgtccactgctccaaggtgcggtccctgacgctg
gactcgtgggagcctgagctgctaaagctgatgtgtgagcttggaaacagcgctgtgaat
cagatctatgaggcccagtgtgagggtgcaggcagcaggaaacccacagccagcagctcc
cggcaggacaaggaggcctggatcaaggacaaatacgtggaaaagaagtttctgcggaag
gcgcccatggcaccagccctggaggccccaagacgctggagggtgcagaagtgcctgcgg
ccccacagctctccccgcgctcccactgcccgccgcaaggtccggcttgagcccgttctg
ccctgtgtggccgctctgtcctcagtgggcaccctggatcgtaagttccgccgagactcc
ctcttctgtcccgacgagctggactcgctcttctcctacttcgacgcaggggccgcaggg
gctggccctcgcagtctgagtagcgacagtggccttgggggcagctcggatggcagctcg
gacgtcctggctttcggctcgggctctgtggtggacagcgtcactgaggaggagggtgca
gagtcggaggagtccagcggtgaggcagacggggacactgaggccgaggcctggggcctg
gcggacgtgcgcgagctgcacccggggctcttggcgcaccgcgcagcgcgtgcccgcgac
cttcctgcgctggcggcggcgctggcccacggggccgaggtcaactgggcggacgcggag
gatgagggcaagacgccgctggtgcaggccgtgctagggggctccttgatcgtctgtgag
ttcctgctgcaaaacggagcggacgtgaaccaaagagacagccggggccgggcgcccctg
caccacgccacgctgctgggccgcaccggccaggtttgcctgttcctgaagcggggcgcg
gaccagcacgccctggaccaagagcagcgggacccgttggccatcgcagtgcaggcggcc
aacgctgacatcgtgacactgctccgtctggcgcgcatggcggaggaaatgcgcgaggcc
gaggctgcccctggtcccccgggcgccctggcgggcagccccacggagctccagttccgc
aggtgtatccaggagttcatcagcctccacctggaagagagctag

DBGET integrated database retrieval system