KEGG   Homo sapiens (human): 116985Help
Entry
116985            CDS       T01001                                 

Gene name
ARAP1, CENTD2
Definition
(RefSeq) ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1
  KO
K18439  Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    116985 (ARAP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    116985 (ARAP1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    116985 (ARAP1)
 Endosome - Golgi transport
   Arf GTPase associated proteins
    116985 (ARAP1)
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    116985 (ARAP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PH RhoGAP ArfGap RA PH_11 SAM_1 SAM_2 PH_8 PH_6 PH_13 PH_9 Thioredoxin_6
Motif
Other DBs
NCBI-GeneID: 116985
NCBI-ProteinID: NP_001035207
OMIM: 606646
HGNC: 16925
Ensembl: ENSG00000186635
Vega: OTTHUMG00000157102
Pharos: Q96P48(Tbio)
UniProt: Q96P48
Position
11q13.4
AA seq 1450 aa AA seqDB search
MAEAGDAALSVAEWLRALHLEQYTGLFEQHGLVWATECQGLSDTRLMDMGMLLPGHRRRI
LAGLLRAHTSPAPAPRPTPRPVPMKRHIFRSPPVPATPPEPLPTTTEDEGLPAAPPIPPR
RSCLPPTCFTTPSTAAPDPVLPPLPAKRHLAELSVPPVPPRTGPPRLLVSLPTKEEESLL
PSLSSPPQPQSEEPLSTLPQGPPQPPSPPPCPPEIPPKPVRLFPEFDDSDYDEVPEEGPG
APARVMTKKEEPPPSRVPRAVRVASLLSEGEELSGDDQGDEEEDDHAYEGVPNGGWHTSS
LSLSLPSTIAAPHPMDGPPGGSTPVTPVIKAGWLDKNPPQGSYIYQKRWVRLDTDHLRYF
DSNKDAYSKRFISVACISHVAAIGDQKFEVITNNRTFAFRAESDVERKEWMQALQQAMAE
QRARARLSSAYLLGVPGSEQPDRAGSLELRGFKNKLYVAVVGDKVQLYKNLEEYHLGIGI
TFIDMSVGNVKEVDRRSFDLTTPYRIFSFSADSELEKEQWLEAMQGAIAEALSTSEVAER
IWAAAPNRFCADCGAPQPDWASINLCVVICKRCAGEHRGLGAGVSKVRSLKMDRKVWTET
LIELFLQLGNGAGNRFWAANVPPSEALQPSSSPSTRRCHLEAKYREGKYRRYHPLFGNQE
ELDKALCAAVTTTDLAETQALLGCGAGINCFSGDPEAPTPLALAEQAGQTLQMEFLRNNR
TTEVPRLDSMKPLEKHYSVVLPTVSHSGFLYKTASAGKLLQDRRAREEFSRRWCVLGDGV
LSYFENERAVTPNGEIRASEIVCLAVPPPDTHGFEHTFEVYTEGERLYLFGLESAEQAHE
WVKCIAKAFVPPLAEDLLARDFERLGRLPYKAGLSLQRAQEGWFSLSGSELRAVFPEGPC
EEPLQLRKLQELSIQGDSENQVLVLVERRRTLYIQGERRLDFMGWLGAIQKAAASMGDTL
SEQQLGDSDIPVIVYRCVDYITQCGLTSEGIYRKCGQTSKTQRLLESLRQDARSVHLKEG
EQHVDDVSSALKRFLRDLPDGLFTRAQRLTWLEASEIEDEEEKVSRYRELLVRLPPVNRA
TVKALISHLYCVQCFSDTNQMNVHNLAIVFGPTLFQTDGQDYKAGRVVEDLINHYVVVFS
VDEEELRKQREEITAIVKMRVAGTASGTQHAGDFICTVYLEEKKAETEQHIKVPASMTAE
ELTLEILDRRNVGIREKDYWTCFEVNEREEAERPLHFAEKVLPILHGLGTDSHLVVKKHQ
AMEAMLLYLASRVGDTKHGMMKFREDRSLLGLGLPSGGFHDRYFILNSSCLRLYKEVRSQ
RPWSGAPETSHRPEKEWPIKSLKVYLGVKKKLRPPTCWGFTVVHETEKHEKQQWYLCCDT
QMELREWFATFLFVQHDGLVWPSEPSRVSRAVPEVRLGSVSLIPLRGSENEMRRSVAAFT
ADPLSLLRNV
NT seq 4353 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggctggggatgctgcgctatcggtggccgagtggctgcgggcattgcacctg
gagcagtacacggggctctttgagcagcatggcctggtgtgggccactgagtgccaaggc
ctcagcgacacccgcctgatggacatgggcatgctactccctggtcaccgccgccgcatc
ctggctggcctgctccgtgcccatacctcaccggcccctgcaccccgccccaccccacgg
cctgtgcccatgaagcgccacatcttccgctcaccacctgtgcctgccactccacccgag
ccgctgcccaccactacagaggatgaggggctccccgctgccccacccatcccgccccgg
aggagctgccttccgcccacctgcttcaccaccccatccacagctgccccagaccctgtg
ctgcccccgctgcctgctaagcggcatttggcagagctgagcgttccacccgtgccgccc
cgcaccggacccccccgcctgctggtgagcctgcccactaaggaggaggagtcattgctg
ccatcattatcatcccctccccagccacagtctgaggagcccctgtccaccctcccccag
gggcctccccagcctccctctccacctccctgccccccggagatacctccaaagccggta
cgcctgttcccagagttcgatgactctgactacgatgaggtcccagaggaggggccgggg
gccccagccagagtgatgaccaagaaggaggagcccccaccgagccgagtcccacgggcc
gtgcgcgtggccagtctgctgagcgagggagaggaactgtctggggacgaccaaggggat
gaggaagaggatgaccacgcctatgagggcgtccccaatggcggatggcataccagcagc
ctgagcttgtccttgcccagcacaatagctgcgccacaccccatggacgggccgcctggg
ggctccacccccgtcacaccagtcatcaaggctggctggctggacaagaacccaccgcag
ggatcttacatctatcagaaacgatgggtgagactggatactgatcacctgcgatacttt
gacagtaacaaggacgcttactctaagcgctttatctctgtggcctgcatctcccacgtg
gctgccatcggggaccagaagtttgaagtgatcacaaacaaccgaacctttgccttccgg
gcagagagtgatgtggagcggaaggagtggatgcaggccctgcagcaggccatggctgag
cagcgtgcccgggcccggctctctagcgcttatctgctgggagttccaggctcagagcag
cctgaccgcgctggcagcctggagcttcgtggcttcaagaataagctgtacgtggccgtg
gtcggggacaaagtgcagctctacaagaatctagaggagtaccacctgggcattggcatc
accttcatcgacatgagcgtgggcaacgtgaaggaagtggaccggcgcagcttcgacctc
accacgccctaccgcatcttcagcttctctgctgactcagagctagagaaggagcagtgg
ttggaggccatgcagggagccatcgctgaggccctgtctacctcggaggtggccgagcgc
atctgggctgcagcccccaacaggttctgtgctgactgcggggctcctcagcctgactgg
gcctccatcaacctctgtgttgttatctgcaagcgctgtgcaggggagcaccgtggcctg
ggcgctggcgtctccaaggtgcggagcctgaagatggacaggaaggtgtggacagaaaca
cttatcgagctcttcttacagctggggaatggcgctgggaaccgcttctgggcagccaac
gtgccccccagtgaggccctgcagcccagcagcagccccagcacccggcggtgccacctg
gaggccaagtaccgtgagggcaagtaccgccgctaccacccgctctttggcaaccaggag
gagctggacaaggccctgtgtgctgcagtcaccaccacagacctggctgagacccaggcg
ctcctgggctgtggggctgggatcaactgcttctcgggggaccctgaggcccccacgccc
ctggctcttgcagagcaggcggggcagacgctgcagatggaattccttcggaacaaccgg
accacagaggtgcctcggctggactcgatgaagcccctggaaaagcactactcagttgtc
ctgccgaccgtgagccacagtggcttcctctacaagactgcctctgccggcaagctgcta
caggaccgccgggcccgggaagagttcagccggcgctggtgtgtccttggtgacggggtc
ctgagctactttgagaatgagcgggcagtgacccccaatggagagattcgggccagcgag
attgtgtgcctggcagtgccccctcctgacacccatggctttgagcacacctttgaggtg
tacacggagggagaacggctgtacctgtttgggctggagagtgcggagcaggctcatgag
tgggtcaagtgtattgctaaggcattcgtgcctcccctagccgaggatctgctggcccgg
gattttgagcggctgggacgcctaccctacaaagctggcctgagcctacagcgggcccag
gagggctggttctctctcagtggctcggagctccgtgctgtcttcccggaggggccctgc
gaagagccgctgcaactacggaaactgcaggagctttccatccagggggacagtgagaac
caggtgctggtgctggtggagcgaaggaggacactgtacatacagggcgagcggcggctg
gacttcatgggttggctgggggccatccagaaagcagccgccagcatgggggacacgctg
tcggagcagcagcttggggactcggatatcccggtgatcgtgtaccgctgtgtggactac
atcacgcagtgcggcctgacctccgagggcatctaccgcaagtgtgggcagacatcgaag
acacagcggctgctggagagcctgcggcaggatgcgcgctctgtgcacctcaaggagggc
gagcagcacgtggatgatgtttcctcggcgctcaagcgcttcctgcgcgacctgcctgat
gggctcttcactcgcgcccagcgcctaacctggctggaggcctcagagattgaggacgag
gaggagaaggtctccaggtaccgagagctgctggtgcggctgccccctgtcaaccgggcc
acagtgaaggcccttatcagccacctgtactgtgttcagtgcttctcagacacgaaccag
atgaacgtgcacaacctggcaattgtgtttgggcccacgctcttccagacagatgggcag
gactacaaggctggccgtgtggtggaagacctcattaaccactatgtggtggtgtttagt
gtggatgaggaagagctcaggaagcagcgggaggagatcactgccattgtgaagatgcgc
gtggctggcactgccagtgggacccagcatgccggtgacttcatctgcacagtgtatctg
gaagagaagaaggcagagactgagcagcatatcaaggtcccagcatccatgactgctgag
gagctcaccctggagatcctggatcgccggaacgtgggcatcagggagaaggactattgg
acctgctttgaggtcaacgagagggaggaggcagagcgccccctgcactttgcggagaag
gtgctgcccatcctgcacgggctgggcacggacagccacctggtggtgaagaagcaccag
gccatggaggccatgctgctgtacctggccagccgtgtcggtgacaccaagcatggcatg
atgaagttccgtgaggaccgcagcctcctgggcctgggcctgccctcaggtggcttccac
gatcgctacttcatcctcaacagcagctgcttgcggctctacaaggaggtccggagccag
aggccgtggagcggggcccctgagaccagtcaccggcctgagaaggagtggcctattaag
agtctcaaagtctacctgggagtgaagaagaaactcaggccacccacctgctggggcttc
acagtggtgcatgagacagagaaacatgagaagcagcagtggtacctctgctgtgacaca
cagatggagctccgggagtggttcgctacctttctgtttgtgcagcatgacggcctggtg
tggccctcagagccctcacgcgtgtcccgggcagtgcctgaggtccggctgggtagtgtg
tcactgatcccccttcgaggtagtgaaaatgaaatgcgccggagtgtggctgccttcacc
gcggaccctctgtctcttctgcgcaacgtctga

DBGET integrated database retrieval system