KEGG   Homo sapiens (human): 117Help
Entry
117               CDS       T01001                                 

Gene name
ADCYAP1R1, PAC1, PAC1R, PACAPR, PACAPRI
Definition
(RefSeq) ADCYAP receptor type I
  KO
K04587  pituitary adenylate cyclase-activating polypeptide type I receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04713  Circadian entrainment
hsa04911  Insulin secretion
hsa04924  Renin secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    117 (ADCYAP1R1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    117 (ADCYAP1R1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    117 (ADCYAP1R1)
   04924 Renin secretion
    117 (ADCYAP1R1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    117 (ADCYAP1R1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    117 (ADCYAP1R1)
G protein-coupled receptors [BR:hsa04030]
 Class B. Secretin receptor family
  Hypothalamic hormone
   Pituitary adenyl cyclase-activating peptide (PACAP)
    117 (ADCYAP1R1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_2 HRM Dicty_CAR
Motif
Other DBs
NCBI-GeneID: 117
NCBI-ProteinID: NP_001109
OMIM: 102981
HGNC: 242
Ensembl: ENSG00000078549
Vega: OTTHUMG00000023884
Pharos: P41586(Tchem)
UniProt: P41586 A0A090N8F8
Structure
PDB: 

Position
7p14.3
AA seq 468 aa AA seqDB search
MAGVVHVSLAALLLLPMAPAMHSDCIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWDN
ITCWKPAHVGEMVLVSCPELFRIFNPDQVWETETIGESDFGDSNSLDLSDMGVVSRNCTE
DGWSEPFPHYFDACGFDEYESETGDQDYYYLSVKALYTVGYSTSLVTLTTAMVILCRFRK
LHCTRNFIHMNLFVSFMLRAISVFIKDWILYAEQDSNHCFISTVECKAVMVFFHYCVVSN
YFWLFIEGLYLFTLLVETFFPERRYFYWYTIIGWGTPTVCVTVWATLRLYFDDTGCWDMN
DSTALWWVIKGPVVGSIMVNFVLFIGIIVILVQKLQSPDMGGNESSIYLRLARSTLLLIP
LFGIHYTVFAFSPENVSKRERLVFELGLGSFQGFVVAVLYCFLNGEVQAEIKRKWRSWKV
NRYFAVDFKHRHPSLASSGVNGGTQLSILSKSSSQIRMSGLPADNLAT
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggctggtgtcgtgcacgtttccctggctgctctcctcctgctgcctatggcccctgcc
atgcattctgactgcatcttcaagaaggagcaagccatgtgcctggagaagatccagagg
gccaatgagctgatgggcttcaatgattcctctccaggctgtcctgggatgtgggacaac
atcacgtgttggaagcccgcccatgtgggtgagatggtcctggtcagctgccctgagctc
ttccgaatcttcaacccagaccaagtctgggagaccgaaaccattggagagtctgatttt
ggtgacagtaactccttagatctctcagacatgggagtggtgagccggaactgcacggag
gatggctggtcggaacccttccctcattactttgatgcctgtgggtttgatgaatatgaa
tctgagactggggaccaggattattactacctgtcagtgaaggccctctacacggttggc
tacagcacatccctcgtcaccctcaccactgccatggtcatcctttgtcgcttccggaag
ctgcactgcacacgcaacttcatccacatgaacctgtttgtgtcgttcatgctgagggcg
atctccgtcttcatcaaagactggattctgtatgcggagcaggacagcaaccactgcttc
atctccactgtggaatgtaaggccgtcatggttttcttccactactgtgttgtgtccaac
tacttctggctgttcatcgagggcctgtacctcttcactctgctggtggagaccttcttc
cctgaaaggagatacttctactggtacaccatcattggctgggggaccccaactgtgtgt
gtgacagtgtgggctacgctgagactctactttgatgacacaggctgctgggatatgaat
gacagcacagctctgtggtgggtgatcaaaggccctgtggttggctctatcatggttaac
tttgtgctttttattggcattatcgtcatccttgtgcagaaacttcagtctccagacatg
ggaggcaatgagtccagcatctacttgcgactggcccggtccaccctgctgctcatccca
ctattcggaatccactacacagtatttgccttctccccagagaatgtcagcaaaagggaa
agactcgtgtttgagctggggctgggctccttccagggctttgtggtggctgttctctac
tgttttctgaatggtgaggtacaagcggagatcaagcgaaaatggcgaagctggaaggtg
aaccgttacttcgctgtggacttcaagcaccgacacccgtctctggccagcagtggggtg
aatgggggcacccagctctccatcctgagcaagagcagctcccaaatccgcatgtctggc
ctccctgctgacaatctggccacctga

DBGET integrated database retrieval system