KEGG   Homo sapiens (human): 117155
Entry
117155            CDS       T01001                                 
Symbol
CATSPER2
Name
(RefSeq) cation channel sperm associated 2
  KO
K16890  cation channel sperm-associated protein 2
Organism
hsa  Homo sapiens (human)
Disease
H02435  Deafness-infertility syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:hsa03037]
    117155 (CATSPER2)
   04040 Ion channels [BR:hsa04040]
    117155 (CATSPER2)
Cilium and associated proteins [BR:hsa03037]
 Motile cilia and associated proteins
  Sperm flagellum proteins
   117155 (CATSPER2)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Calcium channel, sperm-associated (CatSper)
   117155 (CATSPER2)
SSDB
Motif
Pfam: Ion_trans PKD_channel Neur_chan_memb COG2_C TINF2_N
Other DBs
NCBI-GeneID: 117155
NCBI-ProteinID: NP_742093
OMIM: 607249
HGNC: 18810
Ensembl: ENSG00000166762
Pharos: Q96P56(Tchem)
UniProt: Q96P56
Position
15:complement(43628503..43648884)
AA seq 530 aa
MAAYQQEEQMQLPRADAIRSRLIDTFSLIEHLQGLSQAVPRHTIRELLDPSRQKKLVLGD
QHQLVRFSIKPQRIEQISHAQRLLSRLHVRCSQRPPLSLWAGWVLECPLFKNFIIFLVFL
NTIILMVEIELLESTNTKLWPLKLTLEVAAWFILLIFILEILLKWLSNFSVFWKSAWNVF
DFVVTMLSLLPEVVVLVGVTGQSVWLQLLRICRVLRSLKLLAQFRQIQIIILVLVRALKS
MTFLLMLLLIFFYIFAVTGVYVFSEYTRSPRQDLEYHVFFSDLPNSLVTVFILFTLDHWY
ALLQDVWKVPEVSRIFSSIYFILWLLLGSIIFRSIIVAMMVTNFQNIRKELNEEMARREV
QLKADMFKRQIIQRRKNMSHEALTSSHSKIEDSSRGASQQRESLDLSEVSEVESNYGATE
EDLITSASKTEETLSKKREYQSSSCVSSTSSSYSSSSESRFSESIGRLDWETLVHENLPG
LMEMDQDDRVWPRDSLFRYFELLEKLQYNLEERKKLQEFAVQALMNLEDK
NT seq 1593 nt   +upstreamnt  +downstreamnt
atggccgcttaccaacaagaagagcagatgcagcttccccgagctgatgccattcgttca
cgtctcatcgatactttctctctcattgagcatttgcaaggcttgagccaagctgtgccg
cggcacactatcagggagttacttgatccttcccgccagaagaaacttgtattgggagat
caacaccagctagtgcgtttctctataaagcctcagcgtatagaacagatttcacatgcc
cagaggctgttgagcaggcttcatgtgcgctgcagtcagaggccacctctttctttgtgg
gccggatgggtccttgagtgtcctctcttcaaaaacttcatcatcttcctggtctttttg
aatacgatcatattgatggttgaaatagaattgctggaatccacaaataccaaactatgg
ccattgaagctgaccttggaggtggcagcttggtttatcttgcttattttcatcctggag
atccttcttaagtggctatccaacttttctgttttctggaagagtgcctggaatgtcttt
gactttgttgttaccatgttgtccctgcttcccgaggttgtggtattggtaggggtaaca
ggccaatcggtgtggcttcagcttctgaggatctgccgggtgctgaggtctctcaaactc
cttgcacaattccgtcaaattcaaattattattttggtcctggtcagggccctcaagagc
atgaccttcctcttgatgttgctgctcatcttcttctacatttttgctgtgactggtgtc
tacgtcttctcagagtacacccgttcacctcgtcaggacctggagtaccatgtgttcttc
tcggacctcccgaattccctggtaacagtgttcattctcttcaccttggatcattggtat
gcactgcttcaggacgtctggaaggtgcctgaagtcagtcgcatcttcagcagcatctat
ttcatcctttggttgttgcttggctccattatctttcgaagtatcatagtagccatgatg
gttactaactttcagaatatcaggaaagagctgaatgaggagatggcgcgtcgggaggtt
cagctcaaagctgacatgttcaagcggcagatcatccagaggagaaaaaacatgtcacat
gaagcactgacgtcaagccatagcaaaatagaggacagttcaagaggagctagtcaacaa
agggaaagtttggacttatcagaagtgtctgaagtagagtctaattatggtgccactgaa
gaggatttaataacatctgcatcaaaaacagaagagaccttgtcaaaaaagagagagtac
cagtcttcctcctgtgtctcctccacatcctcttcctattcttcctcttctgaatccaga
ttttctgaatctattggtcgtttggactgggagactcttgtgcacgaaaatctgcccggg
ctaatggaaatggatcaggatgaccgtgtttggcccagagactcactcttccgatatttt
gagttgctagaaaagcttcagtataacctagaggaacgtaagaagttacaagagtttgca
gtgcaggcactgatgaacttggaagacaagtaa

DBGET integrated database retrieval system