KEGG   Homo sapiens (human): 117166Help
Entry
117166            CDS       T01001                                 

Gene name
WFIKKN1, C16orf12, RJD2, WFDC20A, WFIKKN
Definition
(RefSeq) WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Kunitz_BPTI Ig_3 I-set Ig_2 ig WAP V-set Kazal_2
Motif
Other DBs
NCBI-GeneID: 117166
NCBI-ProteinID: NP_444514
OMIM: 608021
HGNC: 30912
Ensembl: ENSG00000127578
Vega: OTTHUMG00000090359
Pharos: Q96NZ8(Tbio)
UniProt: Q96NZ8
Structure
PDB: 

Position
16p13.3
AA seq 548 aa AA seqDB search
MPALRPLLPLLLLLRLTSGAGLLPGLGSHPGVCPNQLSPNLWVDAQSTCERECSRDQDCA
AAEKCCINVCGLHSCVAARFPGSPAAPTTAASCEGFVCPQQGSDCDIWDGQPVCRCRDRC
EKEPSFTCASDGLTYYNRCYMDAEACLRGLHLHIVPCKHVLSWPPSSPGPPETTARPTPG
AAPVPPALYSSPSPQAVQVGGTASLHCDVSGRPPPAVTWEKQSHQRENLIMRPDQMYGNV
VVTSIGQLVLYNARPEDAGLYTCTARNAAGLLRADFPLSVVQREPARDAAPSIPAPAECL
PDVQACTGPTSPHLVLWHYDPQRGGCMTFPARGCDGAARGFETYEACQQACARGPGDACV
LPAVQGPCRGWEPRWAYSPLLQQCHPFVYGGCEGNGNNFHSRESCEDACPVPRTPPCRAC
RLRSKLALSLCRSDFAIVGRLTEVLEEPEAAGGIARVALEDVLKDDKMGLKFLGTKYLEV
TLSGMDWACPCPNMTAGDGPLVIMGEVRDGVAVLDAGSYVRAASEKRVKKILELLEKQAC
ELLNRFQD
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccctacgtccactcctgccgctcctgctcctcctccggctgacctcgggggct
ggcttgctgccagggctggggagccacccgggcgtgtgccccaaccagctcagccccaac
ctgtgggtggacgcccagagcacctgtgagcgcgagtgtagcagggaccaggactgtgcg
gctgctgagaagtgctgcatcaacgtgtgtggactgcacagctgcgtggcagcacgcttc
cccggcagcccagctgcgccgacgacagcggcctcctgcgagggctttgtgtgcccacag
cagggctcggactgcgacatctgggacgggcagcccgtgtgccgctgccgcgaccgctgt
gagaaggagcccagcttcacctgcgcctcggacggcctcacctactacaaccgctgctat
atggacgccgaggcctgcctgcggggcctgcacctccacatcgtgccctgcaagcacgtg
ctcagctggccgcccagcagcccggggccgccggagaccactgcccgccccacacctggg
gccgcgcccgtgcctcctgccctgtacagcagcccctccccacaggcggtgcaggttggg
ggtacggccagcctccactgcgacgtcagcggccgcccgccgcctgctgtgacctgggag
aagcagagtcaccagcgagagaacctgatcatgcgccctgatcagatgtatggcaacgtg
gtggtcaccagcatcgggcagctggtgctctacaacgcgcggcccgaagacgccggcctg
tacacctgcaccgcgcgcaacgctgctgggctgctgcgggctgacttcccactctctgtg
gtccagcgagagccggccagggacgcagcccccagcatcccagccccggccgagtgcctg
ccggatgtgcaggcctgcacgggccccacttccccacaccttgtcctctggcactacgac
ccgcagcggggcggctgcatgaccttcccggcccgtggctgtgatggggcggcccgcggc
tttgagacctacgaggcatgccagcaggcctgtgcccgcggccccggcgacgcctgcgtg
ctgcctgccgtgcagggcccctgccggggctgggagccgcgctgggcctacagcccgctg
ctgcagcagtgccatcccttcgtgtacggtggctgcgagggcaacggcaacaacttccac
agccgcgagagctgcgaggatgcctgccccgtgccgcgcacaccgccctgccgcgcctgc
cgcctccggagcaagctggcgctgagcctgtgccgcagcgacttcgccatcgtggggcgg
ctcacggaggtgctggaggagcccgaggccgccggcggcatcgcccgcgtggcgctcgag
gacgtgctcaaggatgacaagatgggcctcaagttcttgggcaccaagtacctggaggtg
acgctgagtggcatggactgggcctgcccctgccccaacatgacggcgggcgacgggccg
ctggtcatcatgggtgaggtgcgcgatggcgtggccgtgctggacgccggcagctacgtc
cgcgccgccagcgagaagcgcgtcaagaagatcttggagctgctggagaagcaggcctgc
gagctgctcaaccgcttccaggactag

DBGET integrated database retrieval system